DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and Y41E3.1

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001041024.1 Gene:Y41E3.1 WormBaseID:WBGene00012762 Length:682 Species:Caenorhabditis elegans

Alignment Length:652 Identity:150/653 (23%)
Similarity:261/653 (40%) Gaps:139/653 (21%)


  Fly    77 TPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFN-DFVNIYF 140
            |.:.|..|.:.||    .|:|...:...            :..:.:.|..|..:..| .|:|   
 Worm    78 TALQSQKCNIPKL----EINGSEVINFF------------KTHAPLECQKKNSIEDNWVFIN--- 123

  Fly   141 ESTLFRFS--------KLRNFTKVDSGN----ITLRVWCWMDYGRLVYHDVFIFLPFPNPQK--- 190
            :..:.||:        |::.|::||..|    ..:.|   :|..|:...|..........||   
 Worm   124 DEAIIRFTEKRAKAKCKIQYFSRVDDNNNKYEEPVEV---LDGDRMNGSDYATISCIQGFQKWKS 185

  Fly   191 ----VNNSAPV----------------KRLSVLILGIDSISHMHYQRYFSR-VRDLIEGLPHTEL 234
                ||:...:                |..:|..||.||:|.|.::|...: |:.|.|.|....|
 Worm   186 ILWDVNDEPEIHERARKMRKEQADPEKKPYNVYFLGFDSLSQMSFRRKLPQTVKFLEETLGSVVL 250

  Fly   235 WGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYGASGGTNF--DRCHLLWHDFQAAGYATIFGED 297
            .|||.||..:....||:|:.|:..|:......|   ...|:  |....:|.::...||.|::.||
 Worm   251 NGYNIVGDGTPQAFIPILTAQTETELPLTRKRY---KNANYVDDVYPFIWKNYSDKGYVTMYAED 312

  Fly   298 SRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSGDRVYHHVLYDFIYRLLP 362
            :...|||||...||:::|||.|.|::..|:...:        :..|.|....|.:..        
 Worm   313 AFSIGTFTYRLKGFRQQPTDHYTRTLFEEVEKLN--------DRNCIGSIPLHRMWL-------- 361

  Fly   363 HMQARMYDRGF-----FAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHG 422
             ...|.:.:.:     |....|::..||........|.:....:..:....:.:.::|::::|||
 Worm   362 -QNGRQFMKKYEDVPRFLLMHQSLLSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVVIVMADHG 425

  Fly   423 LRYGPFVDTFQGMRETSLPIMVAIYPRSLR--ERFPLAFANLEANAHRLVTTYDLHETLKDVVDL 485
            .|:....||.||..|..:|......|:.||  |:......||..||.:|.:.:|:|.:|.|:::|
 Worm   426 HRFAKLRDTHQGQLEERMPFFSISLPKQLRNTEKGRKMEQNLRENAEKLTSPFDIHASLMDILNL 490

  Fly   486 ENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPW--------NVRS 542
            ..|. |..|||.....:..::|:|.|||.:|:|..|.|..|:|.|     :.|        :.:.
 Worm   491 SELG-ENELNRMQDASSKRSLSVFKPIPVDRTCSQAGIEPHWCTC-----LSWKDAMDTGEDRKL 549

  Fly   543 IQRIAKLAVANINR-LLAPYPQCEQLELLNVEDAYLRKQHKLNKTII------------------ 588
            .:|||...|..||: ::|....|..|.|..:.||   |:...:|.::                  
 Worm   550 TRRIANAVVREINKEIVAEKDLCAPLSLAKIIDA---KKLLPDKGLLAYKNVKDADGFVPDLSGS 611

  Fly   589 ---------VRLVTQPGNGHFDATV---LSKNETSLQ-GPITRTDQYRHQSFCA--REAPIEIYC 638
                     ::|.|.||...::.|:   :.::|..|. |.::..:::.....|.  :...:..:|
 Worm   612 TKAAFAHYQLKLQTTPGEAIYEVTLFYDIVRDEVKLDFGSMSHVNKFGDTPHCIIDKNYYLATFC 676

  Fly   639 YC 640
            .|
 Worm   677 VC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 135/551 (25%)
ALP_like 200..485 CDD:293745 78/295 (26%)
Y41E3.1NP_001041024.1 DUF229 78..581 CDD:281053 135/551 (25%)
ALP_like 215..491 CDD:293745 79/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130874115
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.