DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnali1 and dnali1

DIOPT Version :8

Sequence 1:NP_650128.1 Gene:Dnali1 / 41440 FlyBaseID:FBgn0037962 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001103584.2 Gene:dnali1 / 567632 ZFINID:ZDB-GENE-080204-7 Length:257 Species:Danio rerio

Alignment Length:249 Identity:137/250 (55%)
Similarity:175/250 (70%) Gaps:14/250 (6%)


  Fly    14 TLVRYNNPVLVVKHPDKKG--GAPLTEIEMK-----------RPQTAGALLDTKRETEEILNSIL 65
            :|:||.:||||.|:.::|.  ..||.....:           :|::..|..: :::||||||:||
Zfish     7 SLLRYESPVLVSKNTERKSPRSRPLKVSSQQMVESGPVPPPPKPKSPSAEAN-RQQTEEILNAIL 70

  Fly    66 PPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDTRLQQTQARETGICPVRRELYSQCFDEIIRQ 130
            ||:.|.||.|||.|.|||.|.||.|||:|||.||.:||:.|||||||||||||||:|||||:|||
Zfish    71 PPKEWMEDNQLWVQPVSSVPCTRVDVIHLQEQLDKKLQERQARETGICPVRRELYNQCFDELIRQ 135

  Fly   131 VTINCSERGLLLLRIRDEIAMSMEAYETLYCSSVAFGMRKALQAHEEKEMLRDRVKTLELDKEAL 195
            |||||:|||||||::||||.|::.||:|||.||||||||||||..:.|....:::..||.:|..|
Zfish   136 VTINCAERGLLLLQVRDEIRMTIAAYQTLYESSVAFGMRKALQGEQGKSDFENKISELESEKRDL 200

  Fly   196 EEIIADMKLKQEQAERRNAELRASEEKKFTEEITFLKKTNAQLKAQLEGITAPK 249
            |.::.:.|.|.:..|||.||.|..||||..||:.|||:||.|||||||.|...|
Zfish   201 ERLVNEQKAKCDAIERREAERRDIEEKKHAEEVQFLKRTNQQLKAQLESIITLK 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnali1NP_650128.1 Ax_dynein_light 58..244 CDD:313442 121/186 (65%)
dnali1NP_001103584.2 Ax_dynein_light 63..249 CDD:287215 121/186 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284701604
eggNOG 1 0.900 E1_KOG4001
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2586
Inparanoid 1 1.050 255 1.000 Inparanoid score I3090
OMA 1 1.010
OrthoDB 1 1.010 D1375694at2759
OrthoFinder 1 1.000 FOG0005990
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129970
Panther 1 1.100 LDO PTHR13183
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4201
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.