DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnali1 and dyla-1

DIOPT Version :8

Sequence 1:NP_650128.1 Gene:Dnali1 / 41440 FlyBaseID:FBgn0037962 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_510720.1 Gene:dyla-1 / 185634 WormBaseID:WBGene00018307 Length:271 Species:Caenorhabditis elegans

Alignment Length:203 Identity:87/204 (43%)
Similarity:134/204 (66%) Gaps:16/204 (8%)


  Fly    51 LDTKRETEEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDTRLQQTQARETGICPV 115
            ::::.:.:.||:.|||||.:|::|:||:|..|..||||.|:|||:|.|::.|:...|:..||||:
 Worm    60 IESEHQLQLILDCILPPRVYEQNGKLWKQQASLHPATRHDMINLEEKLESELKDRGAKPFGICPI 124

  Fly   116 RRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIAMSMEAYETLYCSSVAFGMRKAL-------Q 173
            ||:||.|.|||:||||:::|.||||||:|:||||.|:..||:.:..|::|:|:||||       :
 Worm   125 RRDLYGQFFDELIRQVSVSCVERGLLLVRVRDEIRMTFAAYQNVLESAIAYGVRKALFIENEQTR 189

  Fly   174 AHEEKEMLRDRVKTLELDKEALEEIIADMKLKQEQAERRNAELRASEEK-KFTEEITFLKKTNAQ 237
            |..|.::.:|:.|.|.|....||:.:|..|:..|:      ||...|:: |.|.|  .|.::|..
 Worm   190 ATTEWKVQKDKNKELHLKIAQLEKKLATDKIVSEE------ELEIVEQRMKDTNE--RLVESNRI 246

  Fly   238 LKAQLEGI 245
            ||.||:.|
 Worm   247 LKNQLQSI 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnali1NP_650128.1 Ax_dynein_light 58..244 CDD:313442 86/194 (44%)
dyla-1NP_510720.1 Ax_dynein_light 67..253 CDD:287215 86/194 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284695745
eggNOG 1 0.900 E1_KOG4001
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I2920
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1375694at2759
OrthoFinder 1 1.000 FOG0005990
OrthoInspector 1 1.000 T474083
orthoMCL 1 0.900 OOG5_129970
Panther 1 1.100 LDO PTHR13183
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4201
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.