DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: glo and Hnrnpf

Sequence 1:NP_650120.1 Gene:glo FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001159899.1 Gene:Hnrnpf MGIID:2138741 Length:415 Species:Mus musculus

Alignment Length:581 Identity:160/582 (27%)
Similarity:230/582 (40%) Gaps:205/582 (35%)


  Fly    35 EDGGGKIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVE 99
            |.|.|.:         |:|||||||.:.:::.:||.:..:.:|.||:|.:.:| :|:.:|||:||
Mouse     6 EGGEGYV---------VKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTR-EGRQSGEAFVE 60

  Fly   100 VASQEDVEEARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTA-----FVVKLRGLPYAVTE 159
            :.|::||:.|.|.::.||||||||||.:...| .:.:.|.||..:|     ..|:|||||:..|:
Mouse    61 LESEDDVKLALKKDRESMGHRYIEVFKSHRTE-MDWVLKHSGPNSADSANDGFVRLRGLPFGCTK 124

  Fly   160 QQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
            ::|.:|||||:|..:  ||...:|..|:.||||||||.||:..|:|||:::|:|||||||:|:||
Mouse   125 EEIVQFFSGLEIVPN--GITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSS 187

  Fly   225 IAEMKRATGAGGGVGG--RPGPYDIRDRGANRGGNDFGGGRNDWGNNGNFGVGANNMLGFNNLPS 287
            ..|::..:........  |||||| |...|.|                  .:|.....|.:.   
Mouse   188 QEEVRSYSDPPLKFMSVQRPGPYD-RPGTARR------------------YIGIVKQAGLDR--- 230

  Fly   288 LMNSGNFGNNQGGNNGNFGNNSGPSNFGNFGGGNNGGNSGNFGNDSGN--SGNFGNFGNNGGGNF 350
             |.||.:....||.....|.:.|           .|..:..||.|...  ||.:.:         
Mouse   231 -MRSGAYSAGYGGYEEYSGLSDG-----------YGFTTDLFGRDLSYCLSGMYDH--------- 274

  Fly   351 GGNNNGGGGFNSGNNFNSPGGVNNFGNNGGSNFGGNGGGGFNNGGNFVSSSGVGNFGPIGGGRNN 415
                                                                             
Mouse   275 ----------------------------------------------------------------- 274

  Fly   416 NNGNFGNSGFGNFGGNNNVGSNFGGGNNGGGGGFNNGSNFGGGNSMGGGGNFGPIGGGRGNDIEY 480
               .:|:|.|       .|.|..|                                         
Mouse   275 ---RYGDSEF-------TVQSTTG----------------------------------------- 288

  Fly   481 YTIHMRGLPYTSFENDVFKFFEPIRPANVRINYNKKGLHSGTADAYFDTYEDSQVAMKRHREQMG 545
            :.:|||||||.:.|||::.||.|:.|..|.|.....|..:|.||..|.|:|::..||.:.|..|.
Mouse   289 HCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQ 353

  Fly   546 SRYIELFYDGKTRGLNGG------------------------EHGGGNGGGGMGNNGGGNF 582
            .||||||.:..|...||.                        ...|..|.|..|.|..|.:
Mouse   354 HRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGY 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 35/74 (47%)
RRM2_hnRNPH_like 146..224 CDD:240948 42/78 (54%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950 33/74 (45%)
HnrnpfNP_001159899.1 RRM1_hnRNPH_hnRNPH2_hnRNPF 10..88 CDD:241173 37/88 (42%)
Interaction with RNA. {ECO:0000250} 81..86 5/5 (100%)
RRM_SF 93..188 CDD:354314 47/97 (48%)
Interaction with RNA. {ECO:0000250} 179..184 4/5 (80%)
zf-RNPHF 255..290 CDD:311844 11/160 (7%)
RRM3_hnRNPH_CRSF1_like 289..363 CDD:240950 33/74 (45%)
Interaction with RNA. {ECO:0000250} 355..360 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91937887
eggNOG 1 0.900 E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D392876at33208
OrthoFinder 1 1.000 FOG0000459
OrthoInspector 1 1.000 T616565
orthoMCL 1 0.900 OOG5_129021
Panther 1 1.100 O PTHR13976
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4231
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.