DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: glo and hnrnph1

Sequence 1:NP_650120.1 Gene:glo FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_991247.1 Gene:hnrnph1 ZFINID:ZDB-GENE-040426-1856 Length:403 Species:Danio rerio

Alignment Length:561 Identity:150/562 (27%)
Similarity:224/562 (40%) Gaps:218/562 (39%)


  Fly    36 DGGGKIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEV 100
            ||.|.:         ||:||||||.:..|:..|.....:.:....||...:| :|:.:|||:||.
Zfish     3 DGEGFV---------VRVRGLPWSCSVDEVQRFFSECKIASNGTSIHFTYTR-EGRPSGEAFVEF 57

  Fly   101 ASQEDVEEARKLNKASMGHRYIEVFTATPKEAKEAMR-------KISGHGTAFVVKLRGLPYAVT 158
            .|:||::.|.|.::.:|||||:|||.:...|....::       :..|.|   :|:|||||:..:
Zfish    58 ESEEDLKIAVKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNCPETGGDG---LVRLRGLPFGCS 119

  Fly   159 EQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRS 223
            :::|.:||:||:|..:  ||...:|.:||:||||||||.|||..|:||.:::|:|||||||||:|
Zfish   120 KEEIVQFFAGLEIVPN--GITLPVDFQGRSTGEAFVQFASQDIAEKALKKHKERIGHRYIEIFKS 182

  Fly   224 SIAEMKRATGAGGGVGG--RPGPYDIRDRGANRGGNDFGGGRNDWGNNGNFGVGANNMLGFNNLP 286
            |.||::........|.|  ||.|||..           ||||                 |:|:: 
Zfish   183 SRAEVRTHYEPQRKVMGMQRPSPYDRP-----------GGGR-----------------GYNSM- 218

  Fly   287 SLMNSGNFGNNQGGNNGNFGNNSGPSNFGNFGGGNNGGNSGNFGNDSGNSGNFGNFGNNGGGNFG 351
                                                                      ..|.:|.
Zfish   219 ----------------------------------------------------------GRGVSFE 225

  Fly   352 GNNNGGGGFNSGNNFNSPGGVNNFGNNGGSNFGGNGGGGFNNGGNFVSSSGVGNFGPIGGGRNNN 416
            ....||                         :||:|..| ::|.:|.|::|              
Zfish   226 RMRRGG-------------------------YGGDGRYG-DSGSSFQSTTG-------------- 250

  Fly   417 NGNFGNSGFGNFGGNNNVGSNFGGGNNGGGGGFNNGSNFGGGNSMGGGGNFGPIGGGRGNDIEYY 481
                                                                            :
Zfish   251 ----------------------------------------------------------------H 251

  Fly   482 TIHMRGLPYTSFENDVFKFFEPIRPANVRINYNKKGLHSGTADAYFDTYEDSQVAMKRHREQMGS 546
            .:|||||||.:.|.|::.||.|:.|..|.:.....|..:|.||..|.|:||:..||.:.:..|..
Zfish   252 CVHMRGLPYRATETDIYNFFSPLNPVRVHLEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQH 316

  Fly   547 RYIELFYDGKTRGLNGGEHGGGNGGGGMGNNGG-GNFSRRI 586
            ||:|||.:....|.:||.  ||...|||||... |:.|:::
Zfish   317 RYVELFLNSTAGGGSGGY--GGQMMGGMGNQSSYGHSSQQM 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 31/74 (42%)
RRM2_hnRNPH_like 146..224 CDD:240948 42/78 (54%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950 30/74 (41%)
hnrnph1NP_991247.1 RRM <5..>74 CDD:223796 25/79 (32%)
RRM1_hnRNPH_hnRNPH2_hnRNPF 6..84 CDD:241173 33/88 (38%)
RRM <57..>168 CDD:223796 47/116 (41%)
RRM_SF 89..184 CDD:302621 45/100 (45%)
RRM3_hnRNPH_hnRNPH2_hnRNPF 251..326 CDD:241178 30/75 (40%)
RRM <251..>307 CDD:223796 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92061316
eggNOG 1 0.900 E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D392876at33208
OrthoFinder 1 1.000 FOG0000459
OrthoInspector 1 1.000 T597435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13976
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4231
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.