DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and MTM2

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_196074.2 Gene:MTM2 AraportID:AT5G04540 Length:833 Species:Arabidopsis thaliana

Alignment Length:1052 Identity:219/1053 (21%)
Similarity:357/1053 (34%) Gaps:391/1053 (37%)


  Fly   928 CLLPGEDLVTDHLRCFLMPDGREDETQCLIPAEGALFLTNYRVIFKGSPCDPLFCEQVIVRTFPI 992
            |||..|.::.:.....|:   ..||.       |.|.|:|:|::|.......|    |.:.|.|.
plant    49 CLLESERIIFEACGVILI---NTDEA-------GTLLLSNFRILFLSEGTRKL----VPLGTIPF 99

  Fly   993 ASLLKEKKISVLYLAHL----DQTLTEGLQLRSSSFQLIKVAFDPEVTPEQIESFRKILSKARHP 1053
            .::.|..|::....::.    :...|..||:.....:::...|.|.             :|.||.
plant   100 VAIEKFNKLAPKVQSNKYHNNENAPTRLLQVTGKDMRIVVYGFRPG-------------TKQRHT 151

  Fly  1054 FDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLKGFAKKTLLRGAKKAGFKQKQQTKRKLVSDYD-- 1116
            ..:          |:|:...|.:..:.|:         ...|..:.|   ....|.:|:::|.  
plant   152 VVD----------TLLRCNKPERVWDLYA---------FTCGPSQFG---NTNPKERLLNEYFRL 194

  Fly  1117 YGSADAQETQSIDDELEDGDEFETQNNAMPRLLTTKDVERMRERSYVQDWKRLGFDAESQRGFRI 1181
            .|.:..:.:.::   :||| .|...|:.                     |             ||
plant   195 LGKSSQRASMNM---IEDG-SFTLSNDL---------------------W-------------RI 221

  Fly  1182 SNANTSYATCRSYPAIIVAPVQCSDAAIMHL----GRCFKGQRIPLPTWRH-ANGALLIRGGQPN 1241
            :|.|::|..|:|||..::.|...||..::..    .||    |:|:.:|.| .:||::.|..|| 
plant   222 TNLNSNYDLCQSYPFALMVPKSISDEELLQTSTFRARC----RLPVISWCHPGSGAVIARSSQP- 281

  Fly  1242 SKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSS 1306
               ::|::.|...::             |:..:|...|                    .|.||..
plant   282 ---LVGLMMNMRSNS-------------DEKLVASFCT--------------------QLAGHKG 310

  Fly  1307 SDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPKNSLAHPFRKMRLYALGEKSQAKSN 1371
            :  |:.|....:|..||.|        :.|.|||                        .|::.||
plant   311 A--RRKLYIVDARPRKNAL--------ANGAKGG------------------------GSESSSN 341

  Fly  1372 MNVDFCADFIPVDYPDIRQSRPAFKKLIRACMPSHNTNEADG-QSFAK----------------- 1418
            .   ..::.:.:...:|...|.:|.:| |..:..|.|..:|| .||.:                 
plant   342 Y---LQSEIVFLGIDNIHAMRESFSRL-RDYLDMHGTTSSDGTSSFLRHGGWTWGGGNLSSMSAS 402

  Fly  1419 --MVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDG 1481
              ::..|.||..|.|::.....:...:.::.:||::...||.|.|.||.|:|.|.||||||:..|
plant   403 VSVLGDSGWLSHIQSILAGVAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFSG 467

  Fly  1482 FRVLVEKEWLAFGHRFAHRSNL----------------------------KPSHANTNIA----- 1513
            |:.||||:||:|||.|:.|..:                            .|..|....:     
plant   468 FQALVEKDWLSFGHPFSDRVGMPNVSESGNFELPIQSSSARSFPSSPVRQSPGSAAAQSSSSSYG 532

  Fly  1514 ---FAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELERSDSGI---- 1571
               ::|.|||:||.:.||.|.:|.||||:..:|.......:||||..||.:.|.||...||    
plant   533 LNNYSPIFLQWLDCISQLMRMYPSAFEFSPTFLVDFIDCLLSCRFGNFLCNSEKERQQCGISETC 597

  Fly  1572 ----AAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPLDIRSQRAPAPLNRIGHSIFDYIERQH 1632
                |.:.|.|.|....|:             .|:                              
plant   598 GCIWAYLADLRSSSGTSHV-------------HCN------------------------------ 619

  Fly  1633 NKTPIFYNFLYSGDKSVTLRPQNNVAALDLWCYYTNEELAQGAPYDLEVTTVDDEIDLSETKGKR 1697
               |.:....|.|    .|.|.....|..||..:   .|....|.:..||         ||:.:.
plant   620 ---PFYDPSRYDG----PLLPPAAALAPTLWPQF---HLRWACPVEPNVT---------ETEDQC 665

  Fly  1698 MVITAGYDNMEKCNPSAYVCLLSEVKQAETERGHLPQKWLQVWNS--LEVPQLEPVARNTSLGNI 1760
            ..:|..|..|:|           |.::||.:...|... ::..|.  |....:...||.::    
plant   666 RAMTVKYSEMKK-----------EKEEAERKVDELSSA-MESLNEELLNERDISRAARESA---- 714

  Fly  1761 FVQTHQHKRSTLEIIMKGRLA---GYQDKYFHPHRFEKHPYTTPTNCNHCT-KLLWGPVGYRCMD 1821
                   ||:|.|..:..|..   |.:.|:              |....|| ::..||       
plant   715 -------KRATKERAVISRAVQSLGCKVKF--------------TRNGDCTVEVEDGP------- 751

  Fly  1822 CGNSYHEKCTEHSMKNCTKYKAIDGAVGPPNVNMSQGDTASIASSAATTARTSSHHFYNQFSSNV 1886
                  :||: ||:..                ..|:.:|..::.|.::..           ..||
plant   752 ------QKCS-HSIPQ----------------KQSEDNTTDVSESISSVT-----------EQNV 782

  Fly  1887 AEN----RTHEG 1894
            .|.    ||.||
plant   783 CEAVCPLRTREG 794

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 21/118 (18%)
Myotub-related 1161..1565 CDD:284109 115/465 (25%)
C1 1791..1838 CDD:237996 9/48 (19%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941 5/12 (42%)
PH 1891..1992 CDD:278594 3/5 (60%)
MTM2NP_196074.2 GRAM 49..108 CDD:214725 19/73 (26%)
Myotub-related 168..587 CDD:284109 127/548 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10807
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.