DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and SBF2

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:XP_005253211.1 Gene:SBF2 HGNCID:2135 Length:1881 Species:Homo sapiens

Alignment Length:2065 Identity:842/2066 (41%)
Similarity:1210/2066 (59%) Gaps:260/2066 (13%)


  Fly     1 MSRLADYFVIVGYDSDKEKTASNVGGQPTCGKIVQRFPEKDWPDTPFIEGIEWFCQPLGWSLSYE 65
            |:||||||::|||  |.||..|..|    .|||:||||:|||.||||.:|||.||||.||.||.|
Human     1 MARLADYFIVVGY--DHEKPGSGEG----LGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRE 59

  Fly    66 KQEPKFFVSVLTDIDANKHYCACLSFHET-VAITQTRSVDDEDETIGSSRLLGATPSSMDGITTT 129
            :::|.|||.||||||:::|||:||:|:|. :.:..|:    ::|..|.:::.|..          
Human    60 RKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTK----KEEIEGEAKVSGLI---------- 110

  Fly   130 STPASITHHSVMYAPKCLVLISRLDCAETFKNCLGTIYTVYIENLAYGLETLIGNILGCIQVPPA 194
             .||.:      :|||.|||:|||...|.|:.|||.|||||:::|...||:||.|:..|: ||.|
Human   111 -QPAEV------FAPKSLVLVSRLYYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACL-VPAA 167

  Fly   195 GGPQVRFSIGAGDKQSLQPPQSSSLPTTGSGVHFLFKQLGIKNVLILLCSVMTENKILFLSKCYW 259
            ||.|..||:||||:|.:|.|...|||.||:.|..||:||||:|||.|.|:|:||||:||.|..:.
Human   168 GGSQKLFSLGAGDRQLIQTPLHDSLPITGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQ 232

  Fly   260 HLTDSCRALVALMYPFRYTHVYIPILPAPLTEVLSTPTPFIMGIHSSLQTEITDLLDVIVVDLDG 324
            .|:|:||||.:||:|.:|::.|||||||.|.||||:|||||:|:||..:|::.:|||||:.||||
Human   233 RLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVFKTDVHELLDVIIADLDG 297

  Fly   325 GLVTIPESLTPPVPILPSPLWEQTQDLLSMILFPNLAQADLAFPTLERPSAIAKTDAQIDKELRA 389
            |.:.|||.:  .:..||.||..|||..||:||.|:|..||.|||.   |.........:|||:||
Human   298 GTIKIPECI--HLSSLPEPLLHQTQSALSLILHPDLEVADHAFPP---PRTALSHSKMLDKEVRA 357

  Fly   390 IFMRLFAQLLQGYRSCLTIIRIHPKPVITFHKAGFLGARDLIESEFLFRVLDSMFFTTFVNERGP 454
            :|:||||||.|||||||.:||||.:|||.|||..|||.|.|:|::||.:||..|.|..||:||||
Human   358 VFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLSGMAFAGFVSERGP 422

  Fly   455 PWRSSDAWDELYSSMNELLKSEAQNRNLVGRTQRFKGYFNFTFPSYFQILTHIQELGRVLYENEG 519
            |:||.|.:|||.:...|.:|.|..|.                    .:::.|::||...|::||.
Human   423 PYRSCDLFDELVAFEVERIKVEENNP--------------------VKMIKHVRELAEQLFKNEN 467

  Fly   520 TLAHISYAQKVLRPPEGAFQRIHQPAFPRISSEKVELIIQEGIRKN-GVPQRFHVTRNQHR-IIP 582
            ...|::: |||.||.||:..|:|...||.|:..:|:.:|||.:.|| ..|.   .||.:.: ::|
Human   468 PNPHMAF-QKVPRPTEGSHLRVHILPFPEINEARVQELIQENVAKNQNAPP---ATRIEKKCVVP 528

  Fly   583 MGPRLPEALDVRPNVQNSARRLEVLRICVSYIFENRITDARKLLPAVMRTLMHRDARLILCREFF 647
            .||.:...:|....|.|||:||||:|.|:|:||||:|.:..|.|||.:|.|..:.||..|..|..
Human   529 AGPPVVSIMDKVTTVFNSAQRLEVVRNCISFIFENKILETEKTLPAALRALKGKAARQCLTDELG 593

  Fly   648 GYVHGNKAVLDHQQFELVVRFMNKALQKSSGIDEYTVAAALLPMSTIFCRKLSTGVVQFAYTEIQ 712
            .:|..|:|:||||||:.::|.||..||..|.::||.:||||||:::.|.|||:.||.|||||.:|
Human   594 LHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQ 658

  Fly   713 DHAIWKNLQFWESTFFQDVQGQIKALYLLHRRQNE--HQKEANCVLDEVP---LEEPTALEITAE 772
            ||.||.|.||||:||:..||.|:::|||..:..|.  |.|:.    |::|   .:|.||:::.||
Human   659 DHPIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHAPHLKQK----DKLPDDHYQEKTAMDLAAE 719

  Fly   773 QLRKSPNIEEEKKAELAKSEESTLYSQAIHFANRMVSLLIPLDVNVDAASKPKPAFRLE--ENQS 835
            |||..|.:.:..:.||.:.||||::||||||||.||:||:|||.:.:...:.......|  .|..
Human   720 QLRLWPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRTSAPGDWESGSNSI 784

  Fly   836 VSNSIMGSHSLSEHSDEGFEENNALEIGVTVGKTISRFIDCVCTEGGVTSEHIRNLHDMVPGVVH 900
            |:|||.||.:.|..::.|||::...:|..:|.:.|:||||.||||.|||.:||::||.|:||:|.
Human   785 VTNSIAGSVAESYDTESGFEDSENTDIANSVVRFITRFIDKVCTESGVTQDHIKSLHCMIPGIVA 849

  Fly   901 MHIESLEPVYLEAKRHPHVQKPKIQTPCLLPGEDLVTDHLRCFLMPDGREDET------QCLIPA 959
            ||||:||.|:.|::|.|.:|||||..|.|||||::|.:.||..|.|||||:.|      ..|:||
Human   850 MHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPA 914

  Fly   960 EGALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIASLLKEKKISVLYLAHLDQTLTEGLQLRSSSF 1024
            |||||||.||::|:|:|.|.|..||.:||:|||||:.|||||::  ...|.|.:.||||:.|:||
Human   915 EGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITM--QNQLQQNMQEGLQITSASF 977

  Fly  1025 QLIKVAFDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLKGFAK 1089
            ||||||||.||:||.:|.|:|.|.|.|:|...|..|||.:..|..|.:.| |.|||.::.:.|: 
Human   978 QLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAGQTTPQIILP-KQKEKNTSFRTFS- 1040

  Fly  1090 KTLLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQ----SIDDELEDGDEFETQNNAMPRLLT 1150
            ||:::|||:||   |....|:.:.....|:...:...    :.||::...||.|...:...:...
Human  1041 KTIVKGAKRAG---KMTIGRQYLLKKKTGTIVEERVNRPGWNEDDDVSVSDESELPTSTTLKASE 1102

  Fly  1151 TKDVERMRERSYVQDWKRLG---FDAESQRG----FRISNANTSYATCRSYPAIIVAPVQCSDAA 1208
            ...:|::.|::..:|::|||   ....|.|.    |||:.:|..|:.|||||.::|.|....|::
Human  1103 KSTMEQLVEKACFRDYQRLGLGTISGSSSRSRPEYFRITASNRMYSLCRSYPGLLVVPQAVQDSS 1167

  Fly  1209 IMHLGRCFKGQRIPLPTWRHA-NGALLIRGGQPNSKSVIGMLK--NTTGSTTNAHHDVTHYPEQD 1270
            :..:.||::..|:|:..|::: :|.||:|.|..:.|.|:|:.|  |:..:...:..:.:...||:
Human  1168 LPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGFHGKGVVGLFKSQNSPQAAPTSSLESSSSIEQE 1232

  Fly  1271 KYFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSSSDDRQP--LTPELSRKHKNNLDISDGNKS 1333
            ||..||:|.:.....|..|.    .|::......|...:|:.  ::..|.:....:||::..|..
Human  1233 KYLQALLNAVSVHQKLRGNS----TLTVRPAFALSPGTERRTSRMSTVLKQVVPGHLDVNPSNSF 1293

  Fly  1334 SQGGKGGTMKGNPK-------------------------------NSLAHPFRKMRLYALGEKSQ 1367
            :|||...:::.:.:                               |.|..  |:..||..|||||
Human  1294 AQGGVWASLRSSTRLISSPTSFIDVGARLAGKDHSASFSNSSYLQNQLLK--RQAALYIFGEKSQ 1356

  Fly  1368 AKSNMNVDFC--ADFIPVDYPDIRQSRPAFKKLIRACMPSHNTNEADGQ-SFAKMVEQSDWLQQI 1429
            .: |..|:|.  .:|:||::.:|||.:.:||||:|||:||  |...|.: :|.|.:..|:|..|:
Human  1357 LR-NFKVEFALNCEFVPVEFHEIRQVKASFKKLMRACIPS--TIPTDSEVTFLKALGDSEWFPQL 1418

  Fly  1430 SSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFG 1494
            ..:|||:..|.:::: ..|||::.||:|.|:|||::|:.||..||:||:|:||::|||||||:||
Human  1419 HRIMQLAVVVSEVLE-NGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFQMLVEKEWLSFG 1482

  Fly  1495 HRFAHRSNLKPSHANTNIAFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFL 1559
            |:|:.||:|..:...:  .|||.||||||.|||:..|:|..||||.:||:|||:|.||.||:|||
Human  1483 HKFSQRSSLTLNCQGS--GFAPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFL 1545

  Fly  1560 FDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPLDIRSQRAPAPLNRIGHSI 1624
            .|.:.||.:.|  .:.|.:|..:||.                                   |..|
Human  1546 LDSDYERLEHG--TLFDDKGEKHAKK-----------------------------------GVCI 1573

  Fly  1625 FDYIERQHNKTPIFYNFLYSGDKSVTLRPQNNVAALDLWCYYTNEELAQGAPYDLEVTT----VD 1685
            ::.|:|.|.::|||:|:|||..:...|:|..||::|..|.||..|.|:.|..||..:.|    ..
Human  1574 WECIDRMHKRSPIFFNYLYSPLEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKHFPS 1638

  Fly  1686 DEIDLSETKG---KRMVITAGYDNMEKCNPSAYVCLLSEVKQAETERGHLPQKWLQVWNSLEVPQ 1747
            ::.||:...|   :|..:...||::....|.|...|.||:::.|.:....|:||.|:|..:.|..
Human  1639 EDSDLAGEAGPRSQRRTVWPCYDDVSCTQPDALTSLFSEIEKLEHKLNQAPEKWQQLWERVTVDL 1703

  Fly  1748 LEPVARNTSLGNIFVQTHQHKRSTLEIIMKGRLAGYQDKYFHPHRFEKHPYTTPTNCNHCTKLLW 1812
            .|....:.|      |.|                           ..:.|....||.        
Human  1704 KEEPRTDRS------QRH---------------------------LSRSPGIVSTNL-------- 1727

  Fly  1813 GPVGYRCMDCGNSYHEKCTEHSMKNCTKYKAIDGAVGPPNVNMSQGDTASIASSAATTARTSSHH 1877
                       .||.::...|.                |:.:|.:...:||:.|.....|.::  
Human  1728 -----------PSYQKRSLLHL----------------PDSSMGEEQNSSISPSNGVERRAAT-- 1763

  Fly  1878 FYNQFSSNVAENRTHEGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQS 1942
            .|:|::|...|||:.||.||||||||||||.||||||..||||||||:.|||:.||.|:||||:.
Human  1764 LYSQYTSKNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEM 1828

  Fly  1943 VTAAQPAQIGAKGVDEKGFFDLKTSKRIYNFYAINANLAQEWIEKLQACL 1992
            |..|.|:....|...:|.|||||||||:|||.|.:...||:|::|:|:|:
Human  1829 VIPAGPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDKIQSCI 1878

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824 56/90 (62%)
DENN 142..325 CDD:280329 106/183 (58%)
dDENN 384..452 CDD:129037 44/68 (65%)
SBF2 585..807 CDD:289132 108/227 (48%)
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 66/120 (55%)
Myotub-related 1161..1565 CDD:284109 158/450 (35%)
C1 1791..1838 CDD:237996 6/47 (13%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941 65/106 (61%)
PH 1891..1992 CDD:278594 62/101 (61%)
SBF2XP_005253211.1 uDENN 1..86 CDD:214824 57/91 (63%)
DENN 116..298 CDD:280329 106/183 (58%)
dDENN 352..420 CDD:129037 44/68 (65%)
SBF2 531..754 CDD:289132 108/227 (48%)
PH-GRAM_MTMR13 882..1000 CDD:275416 66/120 (55%)
Myotub-related 1116..1551 CDD:284109 158/447 (35%)
PH_Sbf1_hMTMR5 1774..1879 CDD:269941 65/106 (61%)
PH 1779..1879 CDD:278594 62/101 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112376277
eggNOG 1 0.900 E1_KOG1090
Hieranoid 1 1.000
Homologene 1 1.000 H41810
Inparanoid 1 1.050 1430 1.000 Inparanoid score I114
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D11535at33208
OrthoFinder 1 1.000 FOG0002360
OrthoInspector 1 1.000 T609761
orthoMCL 1 0.900 OOG5_131105
Panther 1 1.100 O PTHR10807
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8681
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.