DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and Sbf2

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:XP_008758019.1 Gene:Sbf2 RGDID:1588657 Length:1904 Species:Rattus norvegicus

Alignment Length:2107 Identity:843/2108 (40%)
Similarity:1215/2108 (58%) Gaps:321/2108 (15%)


  Fly     1 MSRLADYFVIVGYDSDKEKTASNVGGQPTCGKIVQRFPEKDWPDTPFIEGIEWFCQPLGWSLSYE 65
            |:||||||::||||.:|.      |.....|||:||||::||.||||.:|||.||||.||.||.|
  Rat     1 MARLADYFIVVGYDHEKP------GPGEGLGKIIQRFPQQDWDDTPFPQGIELFCQPGGWHLSRE 59

  Fly    66 KQEPKFFVSVLTDIDANKHYCACLSFHET-VAITQTRSVDDEDETIGSSRLLGATPSSMDGITTT 129
            :::|.|||.||||||:::|||:||:|:|. :.:..|:..:.|.|.:  |.|:             
  Rat    60 RKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEEV--SALI------------- 109

  Fly   130 STPASITHHSVMYAPKCLVLISRLDCAETFKNCLGTIYTVYIENLAYGLETLIGNILGCIQVPPA 194
             .||.:      :|||.|||:||||..|.|:.|||.|||||:::|:..||:||.|:..|: ||.|
  Rat   110 -QPAEV------FAPKSLVLVSRLDYPEIFRACLGLIYTVYVDSLSVSLESLIANLCACL-VPAA 166

  Fly   195 GGPQVRFSIGAGDKQSLQPPQSSSLPTTGSGVHFLFKQLGIKNVLILLCSVMTENKILFLSKCYW 259
            ||.|..||:||||:|.:|.|...|||.||:.|..||:||||:|||.|.|:|:||||:||.|..:.
  Rat   167 GGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLNLFCAVLTENKVLFHSASFQ 231

  Fly   260 HLTDSCRALVALMYPFRYTHVYIPILPAPLTEVLSTPTPFIMGIHSSLQTEITDLLDVIVVDLDG 324
            .|:|:||||.:||:|.:|::.|||||||.|.||||:|||||:|:||..:|::.:|||||:.||||
  Rat   232 RLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSIFKTDVHELLDVIIADLDG 296

  Fly   325 GLVTIPESLTPPVPILPSPLWEQTQDLLSMILFPNLAQADLAFPTLERPSAIAKTDAQIDKELRA 389
            |.:.|||.:  .:..||.||..|||..||:||.|:|..||.|||.   |.........:|||:||
  Rat   297 GTIKIPECI--HLSSLPEPLLHQTQAALSLILHPDLEVADHAFPP---PRTALSHSKMLDKEVRA 356

  Fly   390 IFMRLFAQLLQGYRSCLTIIRIHPKPVITFHKAGFLGARDLIESEFLFRVLDSMFFTTFVNERGP 454
            :|:||||||.|||||||.:||||.:|||.|||..|||.|.|:|::||.:||:.|.|..||:||||
  Rat   357 VFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLNGMAFAGFVSERGP 421

  Fly   455 PWRSSDAWDELYSSMNELLKSEAQNRNLVGRTQRFKGYFNFTFPSYFQILTHIQELGRVLYENEG 519
            |:|:.|.:|||.:...|.:|.|..|.                    .:::.||:||...|::||.
  Rat   422 PYRACDLFDELVAFEVERIKVEENNP--------------------LKMIKHIRELAEQLFKNEN 466

  Fly   520 TLAHISYAQKVLRPPEGAFQRIHQPAFPRISSEKVELIIQEGIRK--NGVPQRFHVTRNQHR-II 581
            ...|::: |||.||.||:..|:|...||:|:..:|:.:|||.:.|  |..|    .||.:.: |:
  Rat   467 PNPHMAF-QKVPRPTEGSHLRVHILPFPKINEARVQELIQENLAKNQNATP----ATRTEKKCIV 526

  Fly   582 PMGPRLPEALDVRPNVQNSARRLEVLRICVSYIFENRITDARKLLPAVMRTLMHRDARLILCREF 646
            |.||.:...:|....|.|||:||||:|.|:|:||||:..:..|.|||.:|.|..:.||..|..|.
  Rat   527 PAGPPVVSIMDKVITVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQCLTDEL 591

  Fly   647 FGYVHGNKAVLDHQQFELVVRFMNKALQKSSGIDEYTVAAALLPMSTIFCRKLSTGVVQFAYTEI 711
            ..:|..|:|:||||||:.::|.||..||..|.::||.:||||||:::.|.|:|:.||.|||||.:
  Rat   592 GLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRRLAPGVSQFAYTCV 656

  Fly   712 QDHAIWKNLQFWESTFFQDVQGQIKALYLLHRRQNE--HQKEANCVLDEVPLEEPTALEITAEQL 774
            |||.||.|.||||:||:..||.|:::|||..:..|.  |||:..  |.:...:|.||:::.||||
  Rat   657 QDHPIWTNQQFWETTFYSAVQEQVRSLYLSAKEDNHTPHQKQKE--LPDGQYQERTAMDLAAEQL 719

  Fly   775 RKSPNIEEEKKAELAKSEESTLYSQAIHFANRMVSLLIPLDVNVD---AASKPKPAFRLEENQSV 836
            |..|.:.:..:.||.:.||||::||||||||.||:||:|||.:.:   .||.|.. :....|..|
  Rat   720 RLWPTLSKATQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRASAPGD-WESGSNSIV 783

  Fly   837 SNSIMGSHSLSEHSDEGFEENNALEIGVTVGKTISRFIDCVCTEGGVTSEHIRNLHDMVPGVVHM 901
            :|||.||.:.|..::.|||::...::..:|.:.|:||||.||||.|||.:|||:||.|:||:|.|
  Rat   784 TNSIAGSVAESFDTESGFEDSENNDVANSVVRFIARFIDKVCTESGVTQDHIRSLHCMIPGIVAM 848

  Fly   902 HIESLEPVYLEAKRHPHVQKPKIQTPCLLPGEDLVTDHLRCFLMPDGREDET------QCLIPAE 960
            |||:||.|:.|::|.|.:|||||..|.|||||::|.:.||..|.|||||:.|      ..|:|||
  Rat   849 HIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPAE 913

  Fly   961 GALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIASLLKEKKISVLYLAHLDQTLTEGLQLRSSSFQ 1025
            ||||||.||::|:|:|.|.|..||.:||:|||||:.|||||::  ...|.|.:.||||:.|:|||
  Rat   914 GALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITM--QNQLQQNMQEGLQITSASFQ 976

  Fly  1026 LIKVAFDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLKGFAKK 1090
            |||||||.||:||.::.|:|.|.|.|:|...|..|||.:..|..|.:.| |.|||.::.:.|: |
  Rat   977 LIKVAFDEEVSPEVVDIFKKQLMKFRYPQSIFSTFAFAAGQTTPQIILP-KQKEKNTSFRTFS-K 1039

  Fly  1091 TLLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQ----SIDDELEDGDEFETQNNAMPRLLTT 1151
            |:::||||||   |....|:.:.....|:...:...    :.:|::...|:.|...:...:....
  Rat  1040 TIVKGAKKAG---KMTIGRQYLLKKRTGTIVEERANRPGWNEEDDISVSDDCELPTSTTLKASEK 1101

  Fly  1152 KDVERMRERSYVQDWKRLG---FDAESQRG----FRISNANTSYATCRSYPAIIVAPVQCSDAAI 1209
            ..:|::.|::..:|::|||   ....|.|.    ||::.:|..|:.|||||.::|.|....|:::
  Rat  1102 STMEQLVEKACFRDYQRLGLGTISGSSSRSKPEYFRVTASNRLYSLCRSYPGLLVIPQAVQDSSL 1166

  Fly  1210 MHLGRCFKGQRIPLPTWRHA-NGALLIRGGQPNSKSVIGMLK--NTTGSTTNAHHDVTHYPEQDK 1271
            ..:.||::..|:|:..|::: :|.||:|.|..:.|.|:|:.|  |:..:.:.:..:.:...||:|
  Rat  1167 PRVARCYRHNRLPVVCWKNSRSGTLLLRSGGFHGKGVVGLFKSQNSPQAVSTSSLESSSSIEQEK 1231

  Fly  1272 YFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSSSDDRQ--PLTPELSRKHK-----------N 1323
            |..||      ||.:.::|         .|.|:|:...|.  .|:|...|:..           .
  Rat  1232 YLQAL------LTAVIVHQ---------KLRGNSTLTVRPTLALSPGTERRSSRMSTVLKQVVPG 1281

  Fly  1324 NLDISDGNKSSQGGKGGTMK----GNPKNSLAHPF------------------------------ 1354
            :||::..|..::|..|...|    .|.|:|...|.                              
  Rat  1282 HLDVNPSNSFARGVHGYRDKCFTQSNSKSSAKEPVHNQGVWASLRSSTRLISSPTSLIDVGARLA 1346

  Fly  1355 --------------------RKMRLYALGEKSQAKSNMNVDFC--ADFIPVDYPDIRQSRPAFKK 1397
                                |:..||..|||||.:|: .|:|.  .:|:||::.:|||.:.:|||
  Rat  1347 GKDHSASFSNSTYLQNQLSKRQAALYIFGEKSQLRSS-KVEFAFNCEFVPVEFHEIRQVKASFKK 1410

  Fly  1398 LIRACMPSHNTNEADGQ-SFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVT 1461
            |:|||:||  |...|.: :|.|.:|.|:|..|:..:|||:..|.:::: ..|||.:.||:|.|:|
  Rat  1411 LMRACIPS--TIPTDSEVTFLKALEDSEWFPQLHRIMQLAVVVSEVLE-NGSSVWVCLEEGWDIT 1472

  Fly  1462 AQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSHANTNIAFAPTFLQFLDVVH 1526
            .|::|:.||..||:||:::|||:|||||||:|||:|:.||:|..:...:  .|||.||||||.||
  Rat  1473 TQVTSLVQLLSDPFYRTIEGFRMLVEKEWLSFGHKFSQRSSLALNSQGS--GFAPIFLQFLDCVH 1535

  Fly  1527 QLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGG 1591
            |:..|:|..||||.:||:|||:|.||.||:|||.|.:.||.:.|  .:.|.:|..:||.      
  Rat  1536 QVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHG--TLFDDKGDKHAKK------ 1592

  Fly  1592 MATNGSDDECSVYPLDIRSQRAPAPLNRIGHSIFDYIERQHNKTPIFYNFLYSGDKSVTLRPQNN 1656
                                         |..|::.|::.|.::|:|:|:|||..:...|:|..|
  Rat  1593 -----------------------------GVCIWECIDKMHKRSPVFFNYLYSPVEIEALKPNVN 1628

  Fly  1657 VAALDLWCYYTNEELAQGAPYDLEVTTVD----DEIDLSETKG---KRMVITAGYDNMEKCNPSA 1714
            |::|..|.|||.|.|:.|..||..:.|..    :|.|::...|   :|..:...||::....|.|
  Rat  1629 VSSLKKWDYYTEETLSAGPSYDWMMLTPKHFPYEESDVAGGAGPQSQRKTVWPCYDDVTCSQPDA 1693

  Fly  1715 YVCLLSEVKQAETERGHLPQKWLQVWNSL-----EVPQLEPVARNTS----LGNIFVQTHQHKRS 1770
            ...|.||:::.|.:....|:||.|:|..:     |.|:.:...|::|    :.:..|.::| ||.
  Rat  1694 LTRLFSEIEKLEHKLNQTPEKWHQLWEKITMDLKEEPRTDHSLRHSSRSPGIASTNVPSYQ-KRP 1757

  Fly  1771 TLEIIMKGRLAGYQDKYFHPHRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSM 1835
            .|..:               ||......:|.|                                 
  Rat  1758 ALHAL---------------HRSPTEDQSTTT--------------------------------- 1774

  Fly  1836 KNCTKYKAIDGAVGPPNVNMSQGDTASIASSAATTARTSSHHFYNQFSSNVAENRTHEGHLYKRG 1900
                         .|.|         .:...|||        .|:|::|...|||:.||.|||||
  Rat  1775 -------------APSN---------GVEHRAAT--------LYSQYTSKNDENRSFEGTLYKRG 1809

  Fly  1901 ALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGAKGVDEKGFFDLK 1965
            |||||||.||||||..||||||||:.|||:.||.|:||||:.|..|.|:....|...:|.|||||
  Rat  1810 ALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVVPAGPSMGAPKYTSDKAFFDLK 1874

  Fly  1966 TSKRIYNFYAINANLAQEWIEKLQACL 1992
            ||||:|||.|.:...||:|::::|:|:
  Rat  1875 TSKRVYNFCAQDGQSAQQWMDRIQSCI 1901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824 53/90 (59%)
DENN 142..325 CDD:280329 107/183 (58%)
dDENN 384..452 CDD:129037 44/68 (65%)
SBF2 585..807 CDD:289132 106/224 (47%)
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 65/120 (54%)
Myotub-related 1161..1565 CDD:284109 162/484 (33%)
C1 1791..1838 CDD:237996 4/47 (9%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941 64/106 (60%)
PH 1891..1992 CDD:278594 61/101 (60%)
Sbf2XP_008758019.1 uDENN 1..86 CDD:214824 54/91 (59%)
DENN 115..297 CDD:280329 107/183 (58%)
dDENN 351..419 CDD:129037 44/68 (65%)
SBF2 530..752 CDD:289132 106/224 (47%)
PH-GRAM_MTMR13 880..998 CDD:275416 65/120 (54%)
Myotub-related 1114..1574 CDD:284109 162/481 (34%)
PH_Sbf1_hMTMR5 1797..1902 CDD:269941 64/106 (60%)
PH 1802..1902 CDD:278594 61/101 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112376307
eggNOG 1 0.900 E1_KOG1090
Hieranoid 1 1.000
Homologene 1 1.000 H41810
Inparanoid 1 1.050 1404 1.000 Inparanoid score I111
OMA 1 1.010
OrthoDB 1 1.010 D11535at33208
OrthoFinder 1 1.000 FOG0002360
OrthoInspector 1 1.000 T618687
orthoMCL 1 0.900 OOG5_131105
Panther 1 1.100 O PTHR10807
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.