DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and CG3530

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_726322.1 Gene:CG3530 FlyBaseID:FBgn0028497 Length:761 Species:Drosophila melanogaster

Alignment Length:916 Identity:178/917 (19%)
Similarity:321/917 (35%) Gaps:290/917 (32%)


  Fly  1017 LQLRSSSFQLIKVAFDPEVTPEQIES----------------FRKILSKARHPFDEFEYFAFQSY 1065
            ::.:.|....::::|| .::||..|.                ..|::|.....|:|..  .|.:.
  Fly    13 IERQLSPTSALRLSFD-NISPETEEPPDGNKRLWGVPVPPFVSEKVVSWIEEEFNEAP--VFYNG 74

  Fly  1066 GTMLQGVAPLKTKEKYSTLKGFAKKTLLRGAKKAGFKQKQQTKRKLVSDYDYGSAD--------- 1121
            .::|:.|..::..::|:| |.....||...|....|.:....|...:......|.:         
  Fly    75 NSVLKKVENVRMIDRYNT-KNPTVGTLYLTATHLIFVEPDSNKETWILHMHVASIEKLPLSTTGS 138

  Fly  1122 -----AQETQSIDDELEDGDEFETQNNAMPRLLTTKDVERMRERSYVQD---------WKRLGFD 1172
                 .:...|:...:....|......::.:|.....:.::...:|..:         |.....:
  Fly   139 PLLIRCKTFLSVTFVIPKDSECHDVYTSLLKLFQPVSINKLYCFNYQPNKDDFPKNAGWDYFKLE 203

  Fly  1173 AE------SQRGFRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRHANG 1231
            ||      ....:.:.:.|..|..|.:||..|..|.:.:...::...|.....|:|:.|:.|.|.
  Fly   204 AEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRFRSKGRLPVLTYLHNNK 268

  Fly  1232 ALLIRGGQPNS---------KSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLA 1287
            |.:.|..||.|         :.::..::.|..:|.               ::.:::|.|::..:|
  Fly   269 ASICRCSQPLSGFSARCLEDEQMLEAIRKTNSNTD---------------YMYVVDTRPRINAMA 318

  Fly  1288 LNQYSGMNLSMSSLMGHSSSDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPKNSLAH 1352
                                                       |:::  |||             
  Fly   319 -------------------------------------------NRAA--GKG------------- 325

  Fly  1353 PFRKMRLYALGEKSQAKSNMNVDFCADFIPVDYPDIRQSRPAFKKLIRACMPSHNTNEADGQSFA 1417
             :.....|.           |:.|  .|:.::  :|...|.:.:|::.||.....|..|    |.
  Fly   326 -YENEAFYE-----------NIKF--HFLGIE--NIHVQRASLQKVLEACEQKSPTMSA----FI 370

  Fly  1418 KMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGF 1482
            ..:|.|.||:.|.|::..|..:.:.:| :..||::...||.|.|||:.|:|||.|:||||::.||
  Fly   371 NALESSGWLKHIRSILDTSSFIANAVD-KGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIKGF 434

  Fly  1483 RVLVEKEWLAFGHRFAHRSNLKPSHANTNI-AFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFL 1546
            :.|:||:||||||:|:.|.    .|..|:. ..:|.|.||||...||..|...|||||:.:|..|
  Fly   435 QALIEKDWLAFGHKFSERC----GHIQTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFLLIL 495

  Fly  1547 AYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPL----- 1606
            ..|..||:|.||:.:||.:|.|..:           |:..|...|...|..::  .:.||     
  Fly   496 HDHVHSCQFGTFVGNCEKDRLDLKL-----------AERTFSLWGYMANHLNE--YINPLYKPNV 547

  Fly  1607 --DIRSQRAPA-----------------PLNRIG----------HSIFDYIERQHNKTPIFYNFL 1642
              .|::..||.                 |...:|          :|:.|:::....:...|.|::
  Fly   548 DEAIKANLAPQCIKFWRGMYSRFESGIHPREPLGDVLLDSKEHCNSLEDHVQHLTKRIASFKNYI 612

  Fly  1643 YSGDKSVTLRPQNNVAALDLWCYYTNEELAQGAPYDLEVTTVDDEIDLSETKGKRMVITAGYDNM 1707
            ....|.:                    :.|..||     ..|:.|:..:|....:.    .||..
  Fly   613 SKSAKKL--------------------QDATSAP-----GKVNKELSSNEINDNKY----NYDKK 648

  Fly  1708 EKCNPSAYVCLLSEVKQAETERGHLPQKWLQVWNSLEVPQLEPVARNTSLGNIFVQTHQ------ 1766
                       |||:..|:.:.   |.|                |.|.|..::.:...|      
  Fly   649 -----------LSELSAADDDH---PLK----------------ASNMSFASLSLSAEQSSPPQA 683

  Fly  1767 --HKRSTLEIIMKGRLAGYQDKYFHPHRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEK 1829
              .:.:::.:..|                   |....|.|:..|..........|..||:.:.|:
  Fly   684 LPEEINSVAVDWK-------------------PMRNVTTCSCSTPFDQFSKKTHCWRCGDIFCER 729

  Fly  1830 CTEHSM 1835
            |.:.::
  Fly   730 CIDKNV 735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 7/46 (15%)
Myotub-related 1161..1565 CDD:284109 107/429 (25%)
C1 1791..1838 CDD:237996 9/46 (20%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
CG3530NP_726322.1 PH-GRAM_MTMR6-like 78..173 CDD:270030 14/96 (15%)
Myotub-related 179..514 CDD:284109 107/433 (25%)
FYVE_MTMR_unchar 693..753 CDD:277277 10/63 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112393153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10807
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.