DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and CG14411

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_001162756.1 Gene:CG14411 FlyBaseID:FBgn0030582 Length:843 Species:Drosophila melanogaster

Alignment Length:1071 Identity:211/1072 (20%)
Similarity:343/1072 (32%) Gaps:414/1072 (39%)


  Fly   882 GVTSEHIRNLHDM----VPGVVHMHIESLEPVYLEAKRHPHVQKPKIQTPCLLPGEDLVTDHLRC 942
            |....|.||....    :||.:....::.|.......|..|:.||:     ||.||.:|......
  Fly    17 GNADHHKRNTFTSYVAPLPGDLRATADTNEWCLPSDLRDVHLAKPR-----LLHGEQIVASAPAY 76

  Fly   943 FLMP------DGREDETQCLI------PAE--------GALFLTNYRVIFKGSPCDPLFCEQVIV 987
            ...|      .|....|...|      ||:        |.|.:||:::.|.     ||..::...
  Fly    77 MYSPIDPMDSSGGSGSTLSAISSASGTPADRHHKEATFGLLSVTNFKLAFV-----PLHEKRNQA 136

  Fly   988 RTFPIASLLKE------KKISVLYLAHLDQTLTE------------------------------- 1015
            .|.|:..|.:|      .:|::..:.|: .|:||                               
  Fly   137 ITAPLIDLYQENTYLGRNEITLNNIDHI-YTITELGRAASALQAARGMASHAGMSRRKKLEPFKQ 200

  Fly  1016 --------GLQLRSSSFQLIKVAFDPEVT-----PEQIESFRKILSKARHPFDEFEYFAFQS--- 1064
                    .|.:...:|:|:|.||..:.:     .:|.:.....|.:..:|......||:..   
  Fly   201 QNISGRIAALHIVCKNFRLLKFAFQQQDSKMFGASDQGKLIASALVRFAYPMRHDLSFAYAHREP 265

  Fly  1065 -YGTM-LQGVAPLKTKEKYSTLKGFAKKTLLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQS 1127
             |.|: ..|.:      .|:|...:|::.:..||          |:.::||        ....|.
  Fly   266 YYSTLGASGTS------MYATKNDWARELIRCGA----------TEWQVVS--------CASVQL 306

  Fly  1128 IDDELEDGDEFETQNNAMPRLLTTKDVERMRERSYVQDWKRLGFDAESQRGFRISNANTSYATCR 1192
            :.:.|:.|                                                   .|    
  Fly   307 LQNPLQAG---------------------------------------------------KY---- 316

  Fly  1193 SYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRHANGALLIRGGQPNSKSVIGMLKNTTGSTT 1257
            :.|...|.|..||....:.|.|.|...|.....:.:.:.|.|:|                     
  Fly   317 TVPPHFVIPKSCSVDRFLDLSRAFCDSRAAFWVYSYGSSAALVR--------------------- 360

  Fly  1258 NAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSSSDDRQPLTPELSRKHK 1322
                                  :.:|.|.|.......|:.:                 ||.||  
  Fly   361 ----------------------LAELQPAAQQDTKSENVML-----------------ELVRK-- 384

  Fly  1323 NNLDISDGNKSSQGGKGGTMKGNPKNSLAHPFRKMRLYALGEKSQAKSNMNVDFCADFIPVDYPD 1387
                       ...|                 |:::|..|.::                   .|.
  Fly   385 -----------CDAG-----------------RQLKLLQLTDR-------------------LPS 402

  Fly  1388 IRQSRPAFKKLIRACMPSHNTNE---ADGQSFAKMVEQSDWLQQIS-SLMQLSGAVVDLID---- 1444
            |:....|::||.|.|.|  .|.|   .....:..::|:::||..:| .|...|.|...|..    
  Fly   403 IQDVLRAYQKLRRLCTP--ETPEKFMLQDDKYLGLLEKTNWLFYVSLCLRYASEASATLRSGVTC 465

  Fly  1445 -LQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFGH----RFAHRSNLK 1504
             ||||       :|.|:...:||:|||.|||::|::|||:.||:|||:|..|    |..|....:
  Fly   466 VLQES-------NGRDLCCVISSLAQLLLDPHFRTIDGFQSLVQKEWVALEHPFQRRLGHVYPAQ 523

  Fly  1505 PSHANTNI---AFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELER 1566
            |:..|..:   ..:|.||.|||.|.||.:|||..|||...||..|........|.||.||.:.:|
  Fly   524 PAGGNAELFDSEQSPVFLLFLDCVWQLLQQFPDEFEFTQTYLTTLWDSCFMPIFDTFQFDTQAQR 588

  Fly  1567 ----SDSGIA-----------AMEDK-----------RGSLNAKHMFGAGGMATNGSDDECSVYP 1605
                :||.:.           :.:||           ||.|.|:    |..:|...|        
  Fly   589 LKAVTDSQLVLRPVWDWGEQFSDKDKMFFSNPLYQRQRGDLGAQ----AAAVAHRRS-------- 641

  Fly  1606 LDIRSQRAPAPLNRIGHSIFDYIERQHNKTPIFYNFLYSGDKSVTLRPQNNVAALDLW--CYYTN 1668
            |.:.|:.|....:.:..|       ::...|..:....|..:...|:|.:.:..|.:|  |||..
  Fly   642 LAVGSKGAHGAASGVTPS-------RNTINPQLFATASSVPQDRYLQPAHRIFDLQVWDQCYYRW 699

  Fly  1669 EELAQ----GAPYDLEVTTVDDEIDL-------SETKGKRMVITAGYDNMEKCNPSAYVCLLSEV 1722
            ..:..    |.|          ::||       :..|.:|.:....:|::    |.||.....|.
  Fly   700 LPILDIRGGGQP----------QVDLYHRLLLSNIAKVQRCLDYQNFDDL----PDAYYEFAGES 750

  Fly  1723 K-------------QAE-----------TERGHLPQKWL-QVWNSLEVPQL-------EPVARNT 1755
            :             :||           |.:...|...| .|..:|::..|       .|:|   
  Fly   751 RPNQHKDEKPDKEDEAEFVDGVERRRKPTAKAATPTSGLTSVTGNLQLSTLSSFFPFGNPIA--- 812

  Fly  1756 SLGNIFVQTHQHKRSTLEIIMKGRLAGYQDK 1786
              |:..:|.:....|:.|::|:  .:.:.||
  Fly   813 --GDAPLQLYDILSSSSELLME--TSSFLDK 839

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 31/184 (17%)
Myotub-related 1161..1565 CDD:284109 95/420 (23%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
CG14411NP_001162756.1 PH-like <114..225 CDD:302622 22/117 (19%)
PTPc <400..587 CDD:304379 70/196 (36%)
3-PAP <666..732 CDD:289355 14/76 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112393169
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10807
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.