DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and Sbf2

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:XP_006507990.1 Gene:Sbf2 MGIID:1921831 Length:1904 Species:Mus musculus

Alignment Length:2098 Identity:839/2099 (40%)
Similarity:1215/2099 (58%) Gaps:303/2099 (14%)


  Fly     1 MSRLADYFVIVGYDSDKEKTASNVGGQPTCGKIVQRFPEKDWPDTPFIEGIEWFCQPLGWSLSYE 65
            |:||||||::||||.:|.     .|.....|||:||||::||.||||.:|||.||||.||.||.|
Mouse     1 MARLADYFIVVGYDHEKP-----AGPGEGLGKIIQRFPQQDWDDTPFPQGIELFCQPGGWHLSRE 60

  Fly    66 KQEPKFFVSVLTDIDANKHYCACLSFHET-VAITQTRSVDDEDETIGSSRLLGATPSSMDGITTT 129
            :::|.|||.||||||:::|||:||:|:|. :.:..|:..:.|.|.:  |.|:             
Mouse    61 RKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEEV--SGLI------------- 110

  Fly   130 STPASITHHSVMYAPKCLVLISRLDCAETFKNCLGTIYTVYIENLAYGLETLIGNILGCIQVPPA 194
             .||.:      :|||.|||:||||..|.|:.|||.|||||:::::..||:||.|:..|: ||.|
Mouse   111 -QPAEV------FAPKSLVLVSRLDYPEIFRACLGLIYTVYVDSMSVSLESLIANLCACL-VPAA 167

  Fly   195 GGPQVRFSIGAGDKQSLQPPQSSSLPTTGSGVHFLFKQLGIKNVLILLCSVMTENKILFLSKCYW 259
            ||.|..||:||||:|.:|.|...|||.||:.|..||:||||:|||.|.|:|:||||:||.|..:.
Mouse   168 GGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLNLFCAVLTENKVLFHSASFQ 232

  Fly   260 HLTDSCRALVALMYPFRYTHVYIPILPAPLTEVLSTPTPFIMGIHSSLQTEITDLLDVIVVDLDG 324
            .|:|:||||.:||:|.:|::.|||||||.|.||||:|||||:|:||..:|::.:|||||:.||||
Mouse   233 RLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSIFKTDVHELLDVIIADLDG 297

  Fly   325 GLVTIPESLTPPVPILPSPLWEQTQDLLSMILFPNLAQADLAFPTLERPSAIAKTDAQIDKELRA 389
            |.:.|||.:  .:..||.||..|||..||:||.|:|..||.|||.   |.........:|||:||
Mouse   298 GTIKIPECI--HLSSLPEPLLHQTQSALSLILHPDLEVADHAFPP---PRTALSHSKMLDKEVRA 357

  Fly   390 IFMRLFAQLLQGYRSCLTIIRIHPKPVITFHKAGFLGARDLIESEFLFRVLDSMFFTTFVNERGP 454
            :|:||||||.|||||||.:||||.:|||.|||..|||.|.|:|::||.:||:.|.|..||:||||
Mouse   358 VFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLNGMAFAGFVSERGP 422

  Fly   455 PWRSSDAWDELYSSMNELLKSEAQNRNLVGRTQRFKGYFNFTFPSYFQILTHIQELGRVLYENEG 519
            |:|:.|.:|||.:...|.:|.|.:|.                    .:::.||:||...|::||.
Mouse   423 PYRACDLFDELVAFEVERIKVEEKNP--------------------LKMIKHIRELAEQLFKNEN 467

  Fly   520 TLAHISYAQKVLRPPEGAFQRIHQPAFPRISSEKVELIIQEGIRKN-GVPQRFHVTRNQHR-IIP 582
            ...|::: |||.||.||:..|:|...||:|:..:|:.:|||.:.|| ..|.   .||.:.: ::|
Mouse   468 PNPHMAF-QKVPRPTEGSHLRVHILPFPKINEARVQELIQENLAKNQNAPP---ATRIEKKCVVP 528

  Fly   583 MGPRLPEALDVRPNVQNSARRLEVLRICVSYIFENRITDARKLLPAVMRTLMHRDARLILCREFF 647
            .||.:...::....|.|||:||||:|.|:|:||||:..:..|.|||.:|.|..:.||..|..|..
Mouse   529 AGPPVVSIMEKVITVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQCLTDELG 593

  Fly   648 GYVHGNKAVLDHQQFELVVRFMNKALQKSSGIDEYTVAAALLPMSTIFCRKLSTGVVQFAYTEIQ 712
            .:|..|:|:||||||:.::|.||..||..|.::||.:||||||:::.|.|||:.||.|||||.:|
Mouse   594 LHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQ 658

  Fly   713 DHAIWKNLQFWESTFFQDVQGQIKALYLLHRRQNE--HQKEANCVLDEVPLEEPTALEITAEQLR 775
            ||.||.|.||||:||:..||.|:::|||..:..|.  |.|:.   |.:...:|.||:::.|||||
Mouse   659 DHPIWTNQQFWETTFYNAVQEQVRSLYLSAKDDNHIPHLKQK---LPDGQHQEKTAMDLAAEQLR 720

  Fly   776 KSPNIEEEKKAELAKSEESTLYSQAIHFANRMVSLLIPLDVNVD---AASKPKPAFRLEENQSVS 837
            ..|.:.:..:.||.:.||||::||||||||.||:||:|||.:.:   .||.|.. :....|..|:
Mouse   721 LWPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRASAPGD-WESGSNSIVT 784

  Fly   838 NSIMGSHSLSEHSDEGFEENNALEIGVTVGKTISRFIDCVCTEGGVTSEHIRNLHDMVPGVVHMH 902
            |||.||.:.|..::.|||::...::..:|.:.|:||||.||||.|||.:|||:||.|:||:|.||
Mouse   785 NSIAGSVAESYDTESGFEDSENSDVANSVVRFIARFIDKVCTESGVTQDHIRSLHCMIPGIVAMH 849

  Fly   903 IESLEPVYLEAKRHPHVQKPKIQTPCLLPGEDLVTDHLRCFLMPDGREDET------QCLIPAEG 961
            ||:||.|:.|::|.|.:|||||..|.|||||::|.:.||..|.|||||:.|      ..|:||||
Mouse   850 IETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPAEG 914

  Fly   962 ALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIASLLKEKKISVLYLAHLDQTLTEGLQLRSSSFQL 1026
            |||||.||::|:|:|.|.|..||.:||:|||||:.|||||::  ...|.|::.||||:.|:||||
Mouse   915 ALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITM--QNQLQQSVQEGLQITSASFQL 977

  Fly  1027 IKVAFDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLKGFAKKT 1091
            ||||||.||:||.::.|:|.|.|.|:|...|..|||.:..|..|.:.| |.|||.::.:.|: ||
Mouse   978 IKVAFDEEVSPEVVDIFKKQLMKFRYPQSIFSTFAFAAGQTTPQIILP-KQKEKNTSFRTFS-KT 1040

  Fly  1092 LLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQ----SIDDELEDGDEFETQNNAMPRLLTTK 1152
            :::||||||   |....|:.:.....|:...:...    :.:|::...|:.|...:...:.....
Mouse  1041 IVKGAKKAG---KMTIGRQYLLKKRTGTIVEERVNRPGWNEEDDISVSDDSELPTSTTLKASEKS 1102

  Fly  1153 DVERMRERSYVQDWKRLG---FDAESQRG----FRISNANTSYATCRSYPAIIVAPVQCSDAAIM 1210
            .:|::.|::..:|::|||   ....|.|.    ||::.:|..|:.|||||.::|.|....|:::.
Mouse  1103 TMEQLVEKACFRDYQRLGLGTISGNSSRSKPEYFRVTASNRLYSLCRSYPGLLVIPQAVQDSSLP 1167

  Fly  1211 HLGRCFKGQRIPLPTWRHA-NGALLIRGGQPNSKSVIGMLK--NTTGSTTNAHHDVTHYPEQDKY 1272
            .:.||::..|:|:..|::: :|.||:|.|..:.|.|:|:.|  |:..:.:.:..:.:...||:||
Mouse  1168 RVARCYRHNRLPVVCWKNSRSGTLLLRSGGFHGKGVVGLFKSQNSPQAVSTSSLESSSSIEQEKY 1232

  Fly  1273 FLALINTMPKLTPLALNQ--YSGMNLSMSSLMGHSSSDDRQP--LTPELSRKHKNNLDISDGNKS 1333
            ..||      ||.:.::|  .....|::...:..|...:|:.  ::..|.:....:||::..|..
Mouse  1233 LQAL------LTAVIVHQKLRGSSTLTVRPALALSPGTERRSSRMSTVLKQVVPGHLDVNPSNSF 1291

  Fly  1334 SQGGKG----GTMKGNPKNSLAHPF---------------------------------------- 1354
            ::|..|    ...:.|||:|...|.                                        
Mouse  1292 ARGVHGYRDKSFTQSNPKSSAKEPVHNQGVWASLRSSTRLISSPTSFIDVGARLAGKDHSASFSN 1356

  Fly  1355 ----------RKMRLYALGEKSQAKSNMNVDFC--ADFIPVDYPDIRQSRPAFKKLIRACMPSHN 1407
                      |:..||..|||||.:|: .|:|.  .:|:||::.:|||.:.:||||:|||:||  
Mouse  1357 STYLQNQLLKRQAALYIFGEKSQLRSS-KVEFAFNCEFVPVEFHEIRQVKASFKKLMRACIPS-- 1418

  Fly  1408 TNEADGQ-SFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLC 1471
            |...|.: :|.|.:..|:|..|:..:|||:..|.:::: ..|||.:.||:|.|:|.|::|:|||.
Mouse  1419 TIPTDSEVTFLKALGDSEWFPQLHRIMQLAVVVSEVLE-NGSSVWVCLEEGWDITTQVTSLAQLL 1482

  Fly  1472 LDPYYRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSHANTNIAFAPTFLQFLDVVHQLQRQFPMAF 1536
            .||:||::.|||.|||||||:|||:|:.||:|..:  :....|||.||||||.|||:..|:|..|
Mouse  1483 SDPFYRTIAGFRTLVEKEWLSFGHKFSQRSSLALN--SQGGGFAPIFLQFLDCVHQVHNQYPTEF 1545

  Fly  1537 EFNDFYLRFLAYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDEC 1601
            |||.:||:|||:|.||.||:|||.|.:.||.:.|  .:.|.:|..:||.                
Mouse  1546 EFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHG--TLFDDKGDKHAKK---------------- 1592

  Fly  1602 SVYPLDIRSQRAPAPLNRIGHSIFDYIERQHNKTPIFYNFLYSGDKSVTLRPQNNVAALDLWCYY 1666
                               |..|::.|::.|.::|||:|:|||..:...|:|..||::|..|.||
Mouse  1593 -------------------GVCIWECIDKMHTRSPIFFNYLYSPVEVEALKPNVNVSSLKKWDYY 1638

  Fly  1667 TNEELAQGAPYDLEVTTVD----DEIDLSETKG---KRMVITAGYDNMEKCNPSAYVCLLSEVKQ 1724
            |.|.|:.|..||..:.|..    :|.|::...|   :|..:...||::....|.|...|.||:::
Mouse  1639 TEETLSAGPSYDWMMLTPKHFPYEESDVAGGAGPQSQRKTVWPCYDDVTCSQPDALTRLFSEIEK 1703

  Fly  1725 AETERGHLPQKWLQVWNSL-----EVPQ----LEPVARNTSLGNIFVQTHQHKRSTLEIIMKGRL 1780
            .|.:....|::|.|:|..:     |.|:    |...|.:..:.:..|.::| ||..|        
Mouse  1704 LEHKLNQTPERWHQLWEKVTTDLKEEPRTAHSLRHSAGSPGIASTNVPSYQ-KRPAL-------- 1759

  Fly  1781 AGYQDKYFHP-HRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSMKNCTKYKAI 1844
                    || ||......:|.|                                          
Mouse  1760 --------HPLHRGLGEDQSTTT------------------------------------------ 1774

  Fly  1845 DGAVGPPNVNMSQGDTASIASSAATTARTSSHHFYNQFSSNVAENRTHEGHLYKRGALLKGWKQR 1909
                .|.|         .:...|||        .|:|::|...|||:.||.||||||||||||.|
Mouse  1775 ----APSN---------GVEHRAAT--------LYSQYTSKNDENRSFEGTLYKRGALLKGWKPR 1818

  Fly  1910 WFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGAKGVDEKGFFDLKTSKRIYNFY 1974
            |||||..||||||||:.|||:.||.|:||||:.|..|.|:....|...:|.|||||||||:|||.
Mouse  1819 WFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAPKYTSDKAFFDLKTSKRVYNFC 1883

  Fly  1975 AINANLAQEWIEKLQACL 1992
            |.:...||:|::::|:|:
Mouse  1884 AQDGQSAQQWMDRIQSCI 1901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824 53/90 (59%)
DENN 142..325 CDD:280329 106/183 (58%)
dDENN 384..452 CDD:129037 44/68 (65%)
SBF2 585..807 CDD:289132 105/224 (47%)
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 65/120 (54%)
Myotub-related 1161..1565 CDD:284109 159/475 (33%)
C1 1791..1838 CDD:237996 4/47 (9%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941 64/106 (60%)
PH 1891..1992 CDD:278594 61/101 (60%)
Sbf2XP_006507990.1 uDENN 1..87 CDD:214824 54/91 (59%)
DENN 116..298 CDD:280329 106/183 (58%)
dDENN 352..420 CDD:129037 44/68 (65%)
SBF2 531..752 CDD:289132 105/224 (47%)
PH-GRAM_MTMR13 880..998 CDD:275416 65/120 (54%)
Myotub-related 1114..1574 CDD:284109 159/472 (34%)
PH_Sbf1_hMTMR5 1797..1902 CDD:269941 64/106 (60%)
PH 1802..1902 CDD:278594 61/101 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112376197
eggNOG 1 0.900 E1_KOG1090
Hieranoid 1 1.000
Homologene 1 1.000 H41810
Inparanoid 1 1.050 1418 1.000 Inparanoid score I116
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002360
OrthoInspector 1 1.000 T616568
orthoMCL 1 0.900 OOG5_131105
Panther 1 1.100 O PTHR10807
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8681
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.