DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sbf and sbf1

Sequence 1:NP_477401.2 Gene:Sbf FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:XP_012813917.1 Gene:sbf1 XenbaseID:XB-GENE-1013544 Length:1923 Species:Xenopus tropicalis

Alignment Length:2102 Identity:834/2103 (40%)
Similarity:1189/2103 (57%) Gaps:292/2103 (14%)


  Fly     1 MSRLADYFVIVGYDSDKEKTASNVGGQPTCGKIVQRFPEKDWPDTPFIEGIEWFCQPLGWSLSYE 65
            |:||||||::||||..|.  .|.:|.    |:|:||||||||.|.||.:|||.||||.||.||.|
 Frog     1 MARLADYFLVVGYDLTKR--GSGIGQ----GRILQRFPEKDWEDNPFPQGIELFCQPSGWQLSTE 59

  Fly    66 KQEPKFFVSVLTDIDANKHYCACLSFHETVAITQTRSVDDEDETIGSSRLLGATPSSMDGITTTS 130
            |:.|.||::|||||.:.:|||:|.:|.|  .:...:|:.|:                .||.....
 Frog    60 KKPPTFFIAVLTDISSERHYCSCFTFWE--ELENIQSLHDQ----------------RDGELEED 106

  Fly   131 TPASITHHSVMYAPKCLVLISRLDCAETFKNCLGTIYTVYIENLAYGLETLIGNILGCIQVPPAG 195
            .|...|  :.:.|||.|||:||||..|.|::.||.|||::.:.|:..||.:|||:|.| .||..|
 Frog   107 APLPST--AQLCAPKTLVLVSRLDHPEVFRDSLGLIYTIHTDGLSVSLENVIGNLLTC-TVPVTG 168

  Fly   196 GPQ-------VR-FSIGAGDKQSLQPPQSSSLPTTGSGVHFLFKQLGIKNVLILLCSVMTENKIL 252
            |.|       || .|:||||:|.:|.|...|||.:...|..||:||||.|||.|.|:.:||:|||
 Frog   169 GSQSDLEQDTVRTISLGAGDRQVIQTPICDSLPISNCSVALLFRQLGITNVLCLFCAALTEHKIL 233

  Fly   253 FLSKCYWHLTDSCRALVALMYPFRYTHVYIPILPAPLTEVLSTPTPFIMGIHSSLQTEITDLLDV 317
            |||..|..||::||||:|:|:|.||:..|:|||||.|.||||||||||:|:::..:.|..:||||
 Frog   234 FLSTSYQRLTEACRALLAIMFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNALFRAETQELLDV 298

  Fly   318 IVVDLDGGLVTIPESLTPPVPILPSPLWEQTQDLLSMILFPNLAQADLAFPTLERPSAI-AKTDA 381
            ::.|||||.||:||.:  .:|.||.||...||:.:|.:|.|:|..||||||    ||:| |.|..
 Frog   299 VIADLDGGTVTVPECV--QIPFLPEPLLHHTQEAISQVLDPSLVIADLAFP----PSSITASTLR 357

  Fly   382 QIDKELRAIFMRLFAQLLQGYRSCLTIIRIHPKPVITFHKAGFLGARDLIESEFLFRVLDSMFFT 446
            ..|.|:||.|:|||||:.||||.||.:|||||:|||.||||.|||.|.|:|.:||.:||:.|.|.
 Frog   358 MQDMEIRASFLRLFAQIFQGYRCCLQLIRIHPEPVIRFHKASFLGQRGLVEDDFLTKVLEGMAFA 422

  Fly   447 TFVNERGPPWRSSDAWDELYSSMNELLKSEAQNRNLVGRTQRFKGYFNFTFPSYFQILTHIQELG 511
            .||.|||.|:|:.|.:|||.:...:.|:.|...:|                     |:.|:::|.
 Frog   423 GFVTERGAPYRALDLFDELVAYEVKKLQYEDTQQN---------------------IIKHVRDLA 466

  Fly   512 RVLYENEGTLAHISYAQKVLRPPEGAFQRIHQPAFPRISSEKVELIIQEGIRK-NGVPQRFHVTR 575
            ..||.||.....:| ..||.||.||::.|.....||.:....::..:.:...| ...|....|.:
 Frog   467 EKLYRNENPYPAVS-MHKVQRPAEGSYMRPQHRPFPMLDESSIQWTLDQAAAKMQHAPPTVRVEK 530

  Fly   576 NQHRIIPMGPRLPEALDVRPNVQ-NSARRLEVLRICVSYIFENRITDARKLLPAVMRTLMHRDAR 639
            .  .::|.||.:....:.....| ||.|||||:|.|:||||||::.:|:||.|||:|.|..|.||
 Frog   531 K--CMVPPGPPIAAIFERNGATQANSNRRLEVVRNCISYIFENKMLEAKKLHPAVLRALKGRAAR 593

  Fly   640 LILCREFFGYVHGNKAVLDHQQFELVVRFMNKALQKSSGIDEYTVAAALLPMSTIFCRKLSTGVV 704
            |.|.:|...:|..|:||||||||:.|||.||..||..:.:||:.:||||||:.|.||||||:|:.
 Frog   594 LCLTQELNLHVQQNRAVLDHQQFDFVVRLMNCCLQDCTPLDEHAIAAALLPLVTAFCRKLSSGIT 658

  Fly   705 QFAYTEIQDHAIWKNLQFWESTFFQDVQGQIKALYLLHRRQNEHQKEANCVLDEVPLEEPTALEI 769
            ||||:.:|:|.:|.|:||||:.|:.|||..|:|||       ...::....:||...||.:|||:
 Frog   659 QFAYSCVQEHVVWTNMQFWEAMFYGDVQNHIRALY-------SSPEDTTTNMDEFEEEERSALEL 716

  Fly   770 TAEQLRKSPNIEEEKKAELAKSEESTLYSQAIHFANRMVSLLIPLDVNVDAASKPKPAFRLEE-- 832
            .|:|.|..|.:..||:.||.:.||||::|||||:||||..||:|||.:.:...:........|  
 Frog   717 AADQCRLWPTLPREKQLELIQKEESTVFSQAIHYANRMSYLLLPLDTSKNRMLRGGAGLGDTESV 781

  Fly   833 -NQSVSNSIMGSHSLSEHSDEGFEENNALEIGVTVGKTISRFIDCVCTEGGVTSEHIRNLHDMVP 896
             |..::||:.||.:.|..::.|||::.:.::...|.:.::||:|.||||.||||||::|||.|:|
 Frog   782 TNSFITNSMAGSMAESADTESGFEDSESSDVAHYVVRFVTRFVDKVCTESGVTSEHLKNLHTMIP 846

  Fly   897 GVVHMHIESLEPVYLEAKRHPHVQKPKIQTPCLLPGEDLVTDHLRCFLMPDGREDETQC------ 955
            .:|.||||:|:.|:.|:||.|.:||||:..|.||.||::|.|.||.:|:|||||:.:..      
 Frog   847 DIVQMHIETLDAVHRESKRLPPIQKPKLLLPTLLAGEEMVMDGLRVYLLPDGREEASGVSLGGPP 911

  Fly   956 LIPAEGALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIASLLKEKKISVLYLAHLDQTLTEGLQLR 1020
            |:|||||||||:||.||||:|.|.|..||.:||:||||||.|||||:|  ...|||.|.|.||||
 Frog   912 LLPAEGALFLTSYRCIFKGTPVDSLVAEQSVVRSFPIASLTKEKKINV--TVQLDQYLQEALQLR 974

  Fly  1021 SSSFQLIKVAFDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLK 1085
            |.:|||:|||||.:|..|..|.|||.|.|.|.|.|....|...: |..:|.....:.|:|..:|.
 Frog   975 SCTFQLLKVAFDEDVPSEASELFRKNLHKLRFPQDVLGTFPLTA-GLTVQHSTQTRAKDKNPSLN 1038

  Fly  1086 --------------GFA----------KKTLLRGAKKAGFKQKQQTKRKLVSDYDY-GSADAQET 1125
                          .|:          .|.|::.|||...:|....::.....:|: ||.::.|.
 Frog  1039 PLHVTDVFQSHVAMSFSLGRFYKDTTLSKNLVKNAKKTIGRQYVTRRKYSPPSWDHRGSQNSLEQ 1103

  Fly  1126 QSIDDELEDGDEFETQNNAMPRLLTTKDVERMRERSYVQDWKRLGFDAES---QRG----FRISN 1183
            ||.|..|.:..|..|...:..:....:.:..:.||:..:|::|:|....|   ||.    ||||.
 Frog  1104 QSDDISLSEEMERNTLTTSTLKAPEKQTIGNVAERACCRDYQRMGLGTLSNSLQRSKNEPFRIST 1168

  Fly  1184 ANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRHANG-ALLIRGGQPNSKSVIG 1247
            .|..||.|.|||.:::.|....|..:..:.||::..|.|:..||.... |:|:|.|..:.|.|:|
 Frog  1169 VNRMYAVCNSYPGLLIVPHSIQDNTLQKISRCYRQNRFPVVCWRSPRSKAVLLRSGGLHGKGVVG 1233

  Fly  1248 MLK--NTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNLSMSSLMGH--SSSD 1308
            :.|  ||| :...:..|.|.. ||:||..|::|.||:..     :.||.|...:....|  .|.|
 Frog  1234 LFKSPNTT-AVGQSQTDSTSL-EQEKYLQAVVNCMPRFA-----EMSGRNTLSAFPSAHLYDSPD 1291

  Fly  1309 DRQPLTPELSRKHKNNLDISDGNKSSQG-------------GKGGTMKGN--------------- 1345
            .|||....|.::.....:.:.|..|.:|             ||.|:|:|:               
 Frog  1292 KRQPKLGSLMKQVIGGKEDNRGGYSVRGIKHPAVRRGYIEQGKWGSMRGSGRLSAYAMNSDVGTR 1356

  Fly  1346 --------------PKNSLAHPFRKMRLYALGEKSQAKSNMNVDFCA--DFIPVDYPDIRQSRPA 1394
                          |..|...| |:..||.:|:|||.| .:..|...  :.:|::..|:||.:.:
 Frog  1357 LAGRELVTHNQNGGPSESALTP-RRAALYIIGDKSQLK-GVKQDPLQQWELVPIELFDVRQVKGS 1419

  Fly  1395 FKKLIRACMPSHNTNEADGQSFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSD 1459
            ||||::||:||..::: ..||:.:.:|.|:||.|:..|:|:|..||:|:| ..|||::.||||.|
 Frog  1420 FKKLMKACVPSAPSSD-PSQSYLRTLEDSEWLVQLHKLLQVSVLVVELLD-SGSSVLVGLEDGWD 1482

  Fly  1460 VTAQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSH--ANTNIAFAPTFLQFL 1522
            :|.|:.|:.||..|||||:::|||:|||||||:|||||:||.    :|  |:.:..|.|.|||||
 Frog  1483 LTTQVVSLVQLLSDPYYRTIEGFRLLVEKEWLSFGHRFSHRG----AHTAASQSNGFTPVFLQFL 1543

  Fly  1523 DVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMF 1587
            |.|||:..|||..|||:.:||:|||||.||.||||||.|.:.||.:.|:  :.:::|        
 Frog  1544 DCVHQVHLQFPSEFEFSQYYLKFLAYHYVSNRFRTFLLDSDCERIEKGV--LYEEKG-------- 1598

  Fly  1588 GAGGMATNGSDDECSVYPLDIRSQRAPAPLNRIGHSIFDYIERQHNKTPIFYNFLYSGDKSVTLR 1652
                                  .:|:|    ::..|:::.:||.|.|:|:|||:::|.:....||
 Frog  1599 ----------------------DRRSP----QVCRSVWECMERLHKKSPVFYNYMFSPEDGEVLR 1637

  Fly  1653 PQNNVAALDLWCYYTNEELAQGAPYDLEVT-----TVDDEIDLSETKGKRMVITAGYDNMEKCNP 1712
            |.::|..|.:|.|||:|.|::|.|||.|:.     ...:..|.|..:.||.:|...|::..:..|
 Frog  1638 PFSSVWGLRVWDYYTHEALSEGPPYDWELLQGPRHEEPERNDSSAPQTKRKIIWPSYNSPARVEP 1702

  Fly  1713 SAYVCLLSEVKQAETERGHLPQKWLQVWNSLEVPQLEPVARNTSLGNIFVQTHQHKRSTLEIIMK 1777
            .|...||.|:...|.:.|.:|::|...|:.::      .|..|.:      .|:.::|: .::|.
 Frog  1703 DAITRLLEELHSLEMDLGQVPERWKDTWDKIK------AAHRTEV------RHESRKSS-ALLMS 1754

  Fly  1778 GRLAGYQDKYFHPHRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSMKNCTKYK 1842
            ..::.        ||                                        ||:   ..|.
 Frog  1755 SSVSS--------HR----------------------------------------HSL---GVYL 1768

  Fly  1843 AIDGAVGPPNVNMSQG-DTASIASSAATT-ARTSSHHFYNQFSSNVAENRTHEGHLYKRGALLKG 1905
            ...|.....|:::..| .|:|..|||... ||.|:...|:||::...|||::||.|:||||.:|.
 Frog  1769 QESGVGSTLNLSLESGQSTSSTPSSAGKLGARNSTSTLYSQFNTAERENRSYEGTLFKRGAFMKP 1833

  Fly  1906 WKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGAKGVDEKGFFDLKTSKRI 1970
            ||.||||||..|||||||::..||..||:|:||||:::|.........|.|||:.||||||::|:
 Frog  1834 WKPRWFVLDKTKHQLRYYESRTDTECKGVIDLAEVEAITPGNQTLGAPKNVDERAFFDLKTTRRV 1898

  Fly  1971 YNFYAINANLAQEWIEKLQACL 1992
            |||.|.:|.|||:||:::|:||
 Frog  1899 YNFCATDALLAQQWIDRIQSCL 1920

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824 52/90 (58%)
DENN 142..325 CDD:280329 102/191 (53%)
dDENN 384..452 CDD:129037 43/68 (63%)
SBF2 585..807 CDD:289132 111/223 (50%)
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 70/120 (58%)
Myotub-related 1161..1565 CDD:284109 172/462 (37%)
C1 1791..1838 CDD:237996 4/47 (9%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941 60/106 (57%)
PH 1891..1992 CDD:278594 56/101 (55%)
sbf1XP_012813917.1 uDENN 1..86 CDD:214824 53/91 (58%)
DENN 117..306 CDD:214823 102/190 (54%)
dDENN 360..428 CDD:129037 43/68 (63%)
SBF2 538..754 CDD:289132 111/223 (50%)
PH-GRAM_MTMR5 883..1001 CDD:275417 70/120 (58%)
Myotub-related 1142..1586 CDD:284109 172/459 (37%)
PH_Sbf1_hMTMR5 1816..1921 CDD:269941 60/106 (57%)
PH 1820..1921 CDD:278594 57/102 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112403111
eggNOG 1 0.900 E1_KOG1090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D11535at33208
OrthoFinder 1 1.000 FOG0002360
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.