DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG34444

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster

Alignment Length:111 Identity:39/112 (35%)
Similarity:62/112 (55%) Gaps:9/112 (8%)


  Fly    89 GREKESPYGALYRWIIYRGIEMVIENMGL-PGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRP 152
            ||:::| ...|.|...|..|....|..|| .|.|||||||||..:..|...:|:||.:::::..|
  Fly   182 GRDRQS-RSLLSRTKFYYIINHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSP 245

  Fly   153 SSS-VDQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMELIS 197
            ||| .::|    .:.|:.:|..| |.|:| ..|..:|:.|.:::|:
  Fly   246 SSSRYEEL----PKRYYIAELDG-RNGNC-GGYRVQCEHSVLDMIT 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 32/89 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47978
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.