DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG34429

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster

Alignment Length:193 Identity:76/194 (39%)
Similarity:108/194 (56%) Gaps:26/194 (13%)


  Fly    30 LIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNSTEI----------------T 78
            ||:|..:|||:|.|.|.|||.|:|..|||.:||||||:|:||.::.::                .
  Fly    44 LIYPRANPTRLQMIAGFGIPAEDLKVESVITGYVLKAQYYLPYSAKQLRTKDVHEISESRLLQNA 108

  Fly    79 RVYLKPMAITGRE-------KESPYGAL--YRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALP 134
            .::.|.|.::.::       .:....||  |||.:|.....:...|.|.||.|:|:.|||.||.|
  Fly   109 TIFDKVMQMSEQKLGFDPDILQEDLQALGSYRWSVYEAFTALAIRMKLNGRVCVLKSICESAAAP 173

  Fly   135 LNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMELIS 197
            .:..:|||||:::|:|.||||||.|.:.||.:|..:|..|..||||...| .||.||.:|..|
  Fly   174 FDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQVY-PRCPKSLLEHFS 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139737944
eggNOG 1 0.900 E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.