DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG34184

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster

Alignment Length:183 Identity:54/184 (29%)
Similarity:83/184 (45%) Gaps:42/184 (23%)


  Fly    46 IGIPVENLHFESVTSGYVLKAEYFLPTNSTEITRVYLKPMAITGREKESPY-------------- 96
            |.:|: .|...:|...|..:..|:.|.:      ||..|..:.|...|..|              
  Fly    35 ISVPL-TLKNRNVFLSYNYEFNYYQPEH------VYKYPPILMGDNWEDSYLTYNTTGGDDSSSS 92

  Fly    97 -----------------GALYRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGE 144
                             ..:.|...|..::..:|..|.|..|||||||||..:..|...:||||.
  Fly    93 RSFRSVDDNSSTQKRTLPIMSRTNFYIMLKDKLERSGYPAESCLLRLICETNSSTLGEVNGLLGS 157

  Fly   145 IMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMELIS 197
            |::|:..||||.|   ::.|::|:.:|..|.|.||| :.|||:|:::.::|||
  Fly   158 IVHILFTPSSSND---ENLDKDYYQAEWDGLRHGDC-SFYASQCEENVLDLIS 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47987
eggNOG 1 0.900 E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.