DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG5768

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_651260.3 Gene:CG5768 FlyBaseID:FBgn0039198 Length:262 Species:Drosophila melanogaster

Alignment Length:185 Identity:46/186 (25%)
Similarity:77/186 (41%) Gaps:18/186 (10%)


  Fly    18 SADGHLKRLSRSLIFPPTSPTR---VQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNSTEITR 79
            |:...|.|..|.:.||..|...   ....|.||.|  ||.:.|:  |......|.||    .:|.
  Fly    75 SSQRKLSRGKRFVAFPQGSSASGAVCLTTGVIGNP--NLLYLSL--GINWGVAYDLP----NVTW 131

  Fly    80 VYLKPMA-ITGREKESPYGALYRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLG 143
            |...... .|.:..::.....:|..:|..:|.:|::||..||.|:||.:||........:..::|
  Fly   132 VLQNAHGWTTKKSAQAQIKRRHRRELYGRLETMIDSMGYNGRDCILRTLCESRQYFQRTKMSMVG 196

  Fly   144 EIMNIVLR-PSSSV--DQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMEL 195
            |::..:.. |...:  .:|.:::|..::...:......|| ..|  .|..|.:||
  Fly   197 EMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDC-TQY--NCHFSLLEL 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG5768NP_651260.3 DM4_12 149..248 CDD:214785 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.