DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG17780

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster

Alignment Length:93 Identity:24/94 (26%)
Similarity:40/94 (43%) Gaps:16/94 (17%)


  Fly   100 YRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSD 164
            :|...|..:..:|:..||.||:|:|:..|  .||..:|..|.|.:::..|.    ::|:      
  Fly   257 FRRDTYELLHELIDRSGLDGRACVLKAYC--TALAGDHGQGFLFKLLKYVF----TLDE------ 309

  Fly   165 REYHTSEHFGK-RGGDCQAAYASRCKKS 191
               |...|... |..:|:....|.|..|
  Fly   310 ---HDKRHMPHLREENCEQIMHSHCPLS 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126
DM4_12 253..338 CDD:214785 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.