DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG14115

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster

Alignment Length:208 Identity:54/209 (26%)
Similarity:89/209 (43%) Gaps:50/209 (24%)


  Fly    30 LIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNST--------EITRVYL---- 82
            |:||...  ....:..:.||:| |..::|...:..::.|.||:|.:        ::...||    
  Fly    25 LVFPRQG--SFGLLAAVAIPLE-LGPKNVYMAFNFESNYALPSNDSYNQWIDRWDLDDHYLGVGG 86

  Fly    83 -----------------KPMAITGREKESPYGALYRWIIYRGIEMVIENMGLPGRSCLLRLICEH 130
                             :...:..|...|| ....|...||.|...:.:.|..|.:||||.|||.
  Fly    87 NVTPINARQDGGDFSQDEDNEVRRRSVGSP-PPFRRHDFYRSIINFLTHYGFNGSACLLRTICEV 150

  Fly   131 AALPLNHESGLLGEIMNIVLRPSSS--------VDQLGQSSDREYHTSEHFGKRGGDCQAAYASR 187
            :..||:.::||||.:..|:..|::|        ||:|.::||.        |..|..| :.|.:.
  Fly   151 SESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDA--------GTHGPGC-SEYVAH 206

  Fly   188 CKKSPMELISLLL 200
            |..|.::|||::|
  Fly   207 CGHSALDLISIVL 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47968
eggNOG 1 0.900 E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.