DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG7201

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster

Alignment Length:116 Identity:32/117 (27%)
Similarity:53/117 (45%) Gaps:18/117 (15%)


  Fly    93 ESPYGALY------RWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLR 151
            |.|.|..:      |.::|..:|..:...|:.|::||||.|||..:..| .:.|:.||:..:.|.
  Fly   192 ELPAGLQHIFHGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSL-EKFGVFGEMTKLFLT 255

  Fly   152 PSSSVDQLGQSSD--REYHTSEHFG---KRGGDCQAAYASRCKKSPMELIS 197
            .:.|     ..||  .:|..::..|   :..|:| ..|...|.||..:.:|
  Fly   256 VTKS-----PFSDLVPDYVQAQEVGEGKQAPGEC-FPYFKDCPKSIFKALS 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.