DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG14829

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster

Alignment Length:153 Identity:41/154 (27%)
Similarity:69/154 (45%) Gaps:18/154 (12%)


  Fly    53 LHFESVTSGYVLKAEYFLPTNSTEITRVYLKPMAITGREKESPYGALYRWIIYRGIEMVIENM-G 116
            |||    ..:.|.:....|.:..|  .:|.:.:....|..:..:....|..:|..:|..::.: |
  Fly    80 LHF----GAFTLPSAPLYPWDKWE--TIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSG 138

  Fly   117 LPGRS--CLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGD 179
            .|||.  ||||.|||:|  .::|..|::.|::.::|.|..:      ..|..|..:...|:.|.|
  Fly   139 SPGRGRHCLLRGICENA--QVHHHVGIMAELLVVLLTPGKT------RLDVAYKEALAAGQAGID 195

  Fly   180 CQAAYASRCKKSPMELISLLLEV 202
            |.|.| |.|.:....|.:..|:|
  Fly   196 CLARY-SDCPRGESVLDAYALDV 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48151
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.