DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG14826

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster

Alignment Length:212 Identity:59/213 (28%)
Similarity:88/213 (41%) Gaps:41/213 (19%)


  Fly    12 SCMHLCSADGHLKRLSRSLIFPPTSPTRVQFIGGIGIPV-ENLHFESVTSGYVLK-AEYFLPTNS 74
            |..:|....||  |..|.||:..:...:......:.||: :.:.|.|....|.|: ..|.|||:.
  Fly    22 SSRNLTEFMGH--RQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSP 84

  Fly    75 ---------------TEITRVYLKPMAITGREKESPYGALYRWIIYRGIEMVIENMG------LP 118
                           .::.|...:.:|..|..    |....|.::|..:|   |.||      ..
  Fly    85 IWPWDKWEGTFARSLMQMRRNIERHVANGGVR----YADDARLLVYTALE---EYMGRRNNDRSM 142

  Fly   119 GRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAA 183
            ||.||||.|||:|  .::|..|:..|||:|||.|..:      ..|.:||.:...|:.|.:|...
  Fly   143 GRQCLLRSICENA--QIHHHIGVFSEIMDIVLSPGKA------DLDNDYHDAYAAGRAGANCLGL 199

  Fly   184 YASRCKKSPMELISLLL 200
            | |.|.:....|..||:
  Fly   200 Y-SACPRGHNFLDGLLI 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 35/105 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48179
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.