DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14720 and CG42811

Sequence 1:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster

Alignment Length:191 Identity:46/192 (24%)
Similarity:76/192 (40%) Gaps:35/192 (18%)


  Fly    30 LIFPPTSPTRVQFIGGIGIPV----ENLHFESVTSGYVLKAEYFLPTNSTEITRVYLKPMAITGR 90
            |:||.:|.  .|....:.:||    ..|.::     :.|:..|.||...:......:.|...:.|
  Fly    28 LLFPASSV--YQITSSLSVPVVIPDRKLFWD-----WGLQMNYALPAEPSSFYAATIWPDEFSRR 85

  Fly    91 EKESPYGALYRWI----------------IYRGIEMVIENMGLPGRSCLLRLICEHAALPLNH-E 138
            .|...:....:::                :|..:|.::...|. ..|||||.:||.|..|... |
  Fly    86 RKRQLWNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGF-DESCLLRSVCELARHPFKDVE 149

  Fly   139 SGLLGEIMNIVLRPS-SSVDQLGQSSDRE-YHTSEHFGKRGGDCQAAYASRCKKSPMELIS 197
            :.:|..::...|.|| ......|::..|| |..:|..|..|.||...| |.|   |::.:|
  Fly   150 NNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLY-SNC---PVDFLS 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 None
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48060
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.