DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fer3 and mespbb

Sequence 1:NP_524322.1 Gene:Fer3 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio

Alignment Length:139 Identity:39/140 (28%)
Similarity:71/140 (51%) Gaps:19/140 (14%)


  Fly    50 QRSQVTPLVPQRPSTNGRA--NGSSS--SSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLR 110
            |...|:|    :|..:|.:  :|..|  ..::||.:..| .||::|:.:|:.||.:|.:|...||
Zfish    44 QAQSVSP----KPEISGSSFQDGGRSRVGVRRTRCKNPS-KQRQSASEKEKLRMRDLTKALHHLR 103

  Fly   111 RKVP--TFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAIHP 173
            ..:|  .....:.|::||||||.|.||.:::..|..:..:..|.| |:  .::|:.:.|     .
Zfish   104 TYLPPSVAPVGQTLTKIETLRLTIRYISYLSAQLGLSEESLCKMR-DL--RVSGYQEMP-----Q 160

  Fly   174 HHLHPAAAY 182
            :|.:..|.:
Zfish   161 NHCYSTAEF 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 20/50 (40%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.