DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MARS and GstE1

Sequence 1:NP_004981.2 Gene:MARS HGNCID:6898 Length:900 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster

Alignment Length:151 Identity:34/152 (22%)
Similarity:70/152 (46%) Gaps:34/152 (22%)


Human    48 VPVLQLDSGNYLFSTSAICRYFFLLSGWEQDD-----------LTNQWLEWEATELQPALSAALY 101
            ||:|. |:|.:::.:.||..|  |:..:.:.|           :.||.|.::|:.:..:::....
  Fly    57 VPMLD-DNGTFIWDSHAIAAY--LVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSR 118

Human   102 YLVVQG--KKGEDVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQ------- 157
            ...:.|  :..::.|.:|.:.|..::..|.  |.|:|||::.:|||:    :..|.:.       
  Fly   119 PFWINGVTEVPQEKLDAVHQGLKLLETFLG--NSPYLAGDSLTLADL----STGPTVSAVPAAVD 177

Human   158 -DPAYLPEELSALHSWFQTLS 177
             |||..|:    :.:|...|:
  Fly   178 IDPATYPK----VTAWLDRLN 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MARSNP_004981.2 Thioredoxin_like <27..68 CDD:294274 7/20 (35%)
GstA <47..189 CDD:223698 34/152 (22%)
GST_C_MetRS_N 77..179 CDD:198340 25/123 (20%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 9/25 (36%)
GstA 8..197 CDD:223698 34/152 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 24/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.