| Sequence 1: | NP_650103.1 | Gene: | CG6830 / 41408 | FlyBaseID: | FBgn0037934 | Length: | 891 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651384.2 | Gene: | CG10560 / 43065 | FlyBaseID: | FBgn0039325 | Length: | 414 | Species: | Drosophila melanogaster | 
| Alignment Length: | 427 | Identity: | 158/427 - (37%) | 
|---|---|---|---|
| Similarity: | 246/427 - (57%) | Gaps: | 17/427 - (3%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    32 PPNKPEPEVDHSDL-VPKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDV 95 
  Fly    96 ELTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAF 160 
  Fly   161 KLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDI 225 
  Fly   226 FVNGVMGNNKEAIIAFMEGMLASFRTS--FMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVD 288 
  Fly   289 PNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFD 353 
  Fly   354 FFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFM 418 
  Fly   419 SDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6830 | NP_650103.1 | EcKinase | 80..372 | CDD:281023 | 110/293 (38%) | 
| EcKinase | 516..800 | CDD:281023 | |||
| CG10560 | NP_651384.2 | EcKinase | 52..333 | CDD:281023 | 110/292 (38%) | 
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45442525 | |
| Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I17979 | 
| eggNOG | 1 | 0.900 | - | - | E1_2AMXB | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D101022at50557 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000277 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11012 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.850 | |||||