DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG10560

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster

Alignment Length:427 Identity:158/428 (37%)
Similarity:246/428 (57%) Gaps:17/428 (4%)


  Fly    32 PPNKPEPEVDHSDL-VPKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDV 95
            ||...:..|...:: :|.|:....||:||..:|..:.|....|.|..:|.||||||:|||:.:||
  Fly     2 PPQTNDENVCEREVPIPGWVKPEVFEDLLKDNVKDYKKTKALRAKAGVAAGENYATIMLRLELDV 66

  Fly    96 ELTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAF 160
            |..|||....:||:|.||||....:::...|.|..|...|..::|::|::|:..||::||...|:
  Fly    67 ETKDKSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAY 131

  Fly   161 KLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDI 225
            ::..::     |.||:.||...||||::||:.|:...|:..|.:.||:|||.|..|.:.|||.:.
  Fly   132 EIKVSE-----NYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEK 191

  Fly   226 FVNGVMGNNKEAIIAFMEGMLASFRTS--FMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVD 288
            :.||.. .:||.:..|.:      |::  .:.|:|::.....|.:.|:.....|...:..:....
  Fly   192 YTNGFF-KSKEIMNFFCD------RSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPK 249

  Fly   289 PNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFD 353
            .:|||||||||.|.||::|:.|...::.:..|||.|.||:||.|.||.||::||..:|.|...||
  Fly   250 SDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFD 314

  Fly   354 FFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFM 418
            :|:..|...|||||.:|.::.:.|:||.:...|.||.||....:|||:.:||||||..|.||..:
  Fly   315 YFVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKII 379

  Fly   419 SDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455
            |:  :..:|..|:|.|.|.:.:::.:||||.:||.||
  Fly   380 SN--EHSNFTNSIYTNPRYRRHMKVVLPWLQHRGALE 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 110/294 (37%)
EcKinase 516..800 CDD:281023
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 110/293 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131025735
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.