DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG10553

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster

Alignment Length:425 Identity:164/426 (38%)
Similarity:242/426 (57%) Gaps:14/426 (3%)


  Fly    32 PPNKPEPEVDHSDLVPKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVE 96
            |..|.|........:|.|:..|.|||||...|..:......|....:|.||||||:||||.:|||
  Fly     3 PQTKDEDVSQKQVTIPDWVKPTVFEELLKRIVKDYKATKSMRANAGVAAGENYATVMLRIELDVE 67

  Fly    97 LTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFK 161
            ..|.:....:||:|.||.:.|..:::...:.|..|...|.|::|::|:||:..||::||....:.
  Fly    68 KEDNTQTTKAFMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELYD 132

  Fly   162 LDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIF 226
            ::|:.     ..||:.||...||.||:|||.::...|:..|.:.||:|||.|..|:..|||.:.:
  Fly   133 IEASD-----YYVLLEDLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEKY 192

  Fly   227 VNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMK-LGIVDPN 290
            ..|.: .|:|.:.||:...:    ..|:.|:...|..|.|...| :.::|.|.|.:: |....|:
  Fly   193 TKGFL-RNEEIVDAFINRSI----KVFLDNVHLCKGYETYLNDL-RIVSGKTFEIVESLNNPSPD 251

  Fly   291 EFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFF 355
            ||.||||||.|.||::.:.|:.|:::|..|||.|.||:||...||.||::||..:|.|.|.||:|
  Fly   252 EFIALNHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYF 316

  Fly   356 IRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSD 420
            |..|...|||||.:||::...|:||.::..|.||.||....|.::|..|||||...|.||..:.|
  Fly   317 IWFYHSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKVLGD 381

  Fly   421 SADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455
              |..||:.|||.|.|.::::|.:||||.:||.:|
  Fly   382 --DDCSFKNSLYINPRFRKHMEVLLPWLQHRGAME 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 115/293 (39%)
EcKinase 516..800 CDD:281023
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 115/292 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131025814
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.