DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31370

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster

Alignment Length:419 Identity:100/420 (24%)
Similarity:183/420 (44%) Gaps:59/420 (14%)


  Fly   480 DQ--IPDWLNIDDFKEIILS--AEPNFEKILSSTSKLATKP----GDNFASKLLKVEIEAQLKDN 536
            ||  :|:|||.....:::.|  .||:..     .:||...|    |||:||.:::..:| .:...
  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLR-----VTKLDFTPGSAKGDNYASVIIRARVE-YITQK 66

  Fly   537 SVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVS 601
            ...:.|.|:|...:    .|:...||..||.:|...:|.|.|..::              :.|.|
  Fly    67 GFFSKSLIIKTVLE----MFAGSALFKTEIGMYRKVLPEFARILRE--------------NNDTS 113

  Fly   602 KEY--LLLENLQPSGFKMVDRMIGMD--------LEHSK-C-TLKKLAQWHAASLKYKELNGPYS 654
            :.|  .:..:|:||...:.:.:..||        |.|.: | ...|||::||.|:|.......:.
  Fly   114 RLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFV 178

  Fly   655 PKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDR---ILEDAKIN 716
            .::.:||.......:..||  ...|.|:..:.:.|....:..|: |:  .::||   |:::.:.|
  Fly   179 KEFKDGICLVDIPYMSSGM--GPFKDFLGRIPELDRYKTHFEKI-EV--HFIDRLRDIMKEYQTN 238

  Fly   717 EQ-AFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQ 779
            .| .:.||.|||....|||.::..: |..::.:|||:|.......|.||.|.|......:.::.:
  Fly   239 PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303

  Fly   780 FDYLIRWYHQNMKEHAKLLNYNGFIPS----LKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDF 840
            .:.|:.:|...::|..:.:.|.|.:|.    .||::.:.....:|.:..:..::.:.|...|::.
  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEE 368

  Fly   841 TTDSFLGNEENGKSLREAMFSNERYRANI 869
            |.|......|..||:. |.|....|..|:
  Fly   369 TDDKLQDFIEECKSIL-ARFERSGYFENL 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 72/305 (24%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/301 (24%)
APH <202..320 CDD:279908 30/121 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55545
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.