DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG11893

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster

Alignment Length:428 Identity:100/429 (23%)
Similarity:184/429 (43%) Gaps:69/429 (16%)


  Fly    32 PPNKPEPEVDHSDL-VPKWLNQTQFEELLAADVDQFSK-----IVGFRVKPAMAPGENYATLMLR 90
            |.|....:.:..:| .|.|||.....::|..    :.|     :...::.||.|.|::||::|.|
  Fly     2 PENADTEQFNADELEAPAWLNAQFITDVLRT----YEKCPELEVTDLKITPASAQGDHYASVMFR 62

  Fly    91 ISIDVELTDKSTKLVS--FMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDI 153
            .:  .|.|....|...  .:..:|......:.|:|.::.|::|..|||:.||:.|.:.:..|.|.
  Fly    63 TT--AEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDT 125

  Fly   154 K-FAPRAFKLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQ 217
            | |.|..:.   :.||:  ..::..||...|:..| |...:|:.:.|...::||::||..   ::
  Fly   126 KLFVPCIYH---SLEPR--QVLIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVS---MK 181

  Fly   218 VHGPYPDI---FVNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEK------- 272
            |....|||   |..|:|    |......:.|:.:...:|:..:|:.....:|:...||       
  Fly   182 VLNEQPDILKDFKYGLM----EMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQ 242

  Fly   273 ALAGLTMEFMKLGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLY 337
            .:..:..|:.|  .|..:.:..:.|||....|::|..|     |:::|||||........:||.|
  Fly   243 RMGDVMQEYRK--NVQSDGYYVMCHGDFHGRNMMFNKN-----EEVMFVDFQICNLCPITIDLSY 300

  Fly   338 FIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFTGRKPS----LRELHRTLIKYGGWVLFPTI 398
            .:...::.:.:.......|..|...|...|..:|:.|:.|:    .:::||.  |:..:.|..|.
  Fly   301 SVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRH--KFYDFFLLTTF 363

  Fly   399 SVLPLV-------------LLDP---TQSATFDNFMSD 420
            |  |::             :.||   .:|..:|.::.|
  Fly   364 S--PMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQD 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 74/305 (24%)
EcKinase 516..800 CDD:281023
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 74/305 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55530
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.