DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31104

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster

Alignment Length:407 Identity:104/408 (25%)
Similarity:178/408 (44%) Gaps:55/408 (13%)


  Fly   478 NTD--QIPDWLNIDDFKEIILSAE--PNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSV 538
            |.|  |.|.|||.....:|:...|  |:. |:.......||..||::||.:.:.::|......  
  Fly     9 NADELQAPAWLNAQFIGDILREYEQLPDL-KVTDLQVSPATAQGDHYASVMFRTKVEYTTPKG-- 70

  Fly   539 KTFS-YILKVHSDNDAIN---FSDFNLFPKEIEVYSTYVPAFERFYKDVG-LPVTFSPKSFRLSK 598
            |.|. .|:|...:.:...   .|:.:||..||.:|...:|.|||..::.| ....|.|..:...|
  Fly    71 KFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLK 135

  Fly   599 DVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIF- 662
              .::.::.|:|.|.|:.:: |.....|...|....|||:|||.|:|.......:..::..|:| 
  Fly   136 --PRQVMIFEDLVPQGYTVI-RDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFE 197

  Fly   663 --TEQTAPIFKGMFVNT-KKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINE------- 717
              |..|.|     |:.| ..:|||.:.|...:.:|.|...:|.|.|:.|:  :.:::|       
  Fly   198 MPTIDTDP-----FITTGMTNFIEMLDKMPELRKYKHHFEKIKDNYMQRL--EVEMHEYHKYRRN 255

  Fly   718 QAFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFD 781
            ..:.||.|||..:.|:||::..: |...:.:|:|.|::.......||.|.:....:.:.:.:..:
  Fly   256 DRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGE 320

  Fly   782 YLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFL 846
            .||..|...:....:.:.|.|.:|:.:||.. .||:                ||..|.|...:||
  Fly   321 NLINEYFSVLVATLRKIGYKGDMPTQRELWE-QIQN----------------NKYYDFFLISTFL 368

  Fly   847 ----GNEENGKSLREAM 859
                |.:.|...:.||:
  Fly   369 PIMVGVKSNDLKMHEAL 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 74/301 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 74/301 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55524
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.