DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG6834

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster

Alignment Length:901 Identity:574/902 (64%)
Similarity:705/902 (78%) Gaps:25/902 (3%)


  Fly     1 MGLRNSKEKQSNEVKTS--KQAPKAQVN---------------PEPPAPPNKPEPEVDHSDLVPK 48
            |||||||.|:|.||.::  ....||.:|               .:.| ||..|.| ::.|:|.|:
  Fly     1 MGLRNSKSKKSYEVASAGDLNQKKASINISGSSNAKIKGSTTTADTP-PPQLPCP-IEKSNLGPE 63

  Fly    49 WLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMKVPH 113
            |||||||||||||.||||||||||:||||||||||||||||||||||||||||||||.||:||||
  Fly    64 WLNQTQFEELLAAHVDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKVPH 128

  Fly   114 DTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVLMHD 178
            :.||||||::|||||.|||..|::||||:|||||||||||.|||:|||||:.||||:||||||.|
  Fly   129 NVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKLANTVLMSD 193

  Fly   179 LGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNNKEAIIAFME 243
            |.|:||||:|||||||||||||||.:|||||||.:..|||:|||.|.|||||||.|||.::||.|
  Fly   194 LSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGGNKEVLMAFYE 258

  Fly   244 GMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNEFNALNHGDCWMNNLLFK 308
            ||:|||||:.||||..||||||:|||||||...:.::|..|...||:|||.||||||||||||||
  Fly   259 GMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHGDCWMNNLLFK 323

  Fly   309 MNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFT 373
            ::|.|:::||:||||||||||||..||.|.|::||.|||||.:|::|||||.|.|.:||.:||||
  Fly   324 LDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFT 388

  Fly   374 GRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSADGVSFRGSLYANKRCQ 438
            |::|||||||..:.|:|.|.:||:|.|||:|||||.:||||:||:.||.....|:..||.|||..
  Fly   389 GKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAKFKNLLYTNKRYH 453

  Fly   439 EYIERILPWLDNRGFLEVSTDPLPPELLAALKPQQPQPEN-TDQIPDWLNIDDFKEIILSAEPNF 502
            .|||::||||||:||||..   ...:::|...|...|||| .:||.||||:.||.|:|.||||.|
  Fly   454 GYIEKLLPWLDNKGFLEAY---FINQVVAPETPSSEQPENPKNQILDWLNVSDFAEVISSAEPEF 515

  Fly   503 EKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSDFNLFPKEIE 567
            :||:..:...||||||||||||||::||.||||::.|||||||||...:...||:|.|:||||:|
  Fly   516 DKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKTFSYILKVQPKSTPDNFTDVNMFPKEME 580

  Fly   568 VYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCT 632
            :|..||||||:.|||.||.|||:..||.|:|.|.:||||:||||..||||.|||.|:::||:|.:
  Fly   581 MYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSS 645

  Fly   633 LKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHK 697
            |||||||||||:|||||||.|.|.||:||:.|||..:|..||.:.|:::|.....|:|.||||.|
  Fly   646 LKKLAQWHAASIKYKELNGAYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPK 710

  Fly   698 MPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQD 762
            :..|:|.:||::||||||||||||||||||||||||||||:::||:|||.|||||..||||||||
  Fly   711 LEWIIDNHVDQVLEDAKINEQAFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQD 775

  Fly   763 LYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLT 827
            ||||::||.:||||||:||.|||:||:|:.||.|||.||||:|||.|||||||:||.||.|||::
  Fly   776 LYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLSELHAILIEHPAFAVGTVIS 840

  Fly   828 TLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883
            ||::||  |.:.|..:.|.......::.|..:..||||:|::|::|||:|||||||
  Fly   841 TLTVCL--TDEGFNPELFFVETPESEAFRTKLLGNERYKAHVEKIMPWLNRRGLLD 894

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 213/292 (73%)
EcKinase 516..800 CDD:281023 188/284 (66%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 213/292 (73%)
EcKinase 529..813 CDD:281023 188/284 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131024051
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12411
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.