DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG11891

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster

Alignment Length:429 Identity:111/430 (26%)
Similarity:204/430 (47%) Gaps:27/430 (6%)


  Fly    39 EVDHS-DLVPKWLNQTQFEELLAADVDQFS-KIVGFRVKPAMAPGENYATLMLRISIDVELTDK- 100
            |::.| .:||.||.:...|:.|.:.....| ::|...:|.|:..||||::::.||.::. .||| 
  Fly     4 EINRSAQVVPAWLTRDYVEQKLRSYFRNDSLRLVNLDIKLALGNGENYSSVITRIYVEY-TTDKS 67

  Fly   101 ----STKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIK--FAPRA 159
                ||:...|.     |.....|::.....:..|...|..|||:|.|:.:.:..|.:  ||...
  Fly    68 KDKQSTRFTRFA-----DAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADSRKLFAGTV 127

  Fly   160 FKLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVH-GPYP 223
            : :|..::     :::..|:....::..:||:.|:||.|...|.:||.||||||.:.:.. |.:.
  Fly   128 Y-VDRKRD-----SIIFEDMSLENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALAERQPGIFA 186

  Fly   224 DIFVNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEF-MKLGIV 287
            ..|..|....:.......|:.:|.:...|.....|..   :.|:.|:::.:..: ||: .:...:
  Fly   187 KNFDRGFFNQHTRGYEPIMKNLLMALSRSLELEPDLC---QRYQAKIDRLVENV-MEYGERSTTI 247

  Fly   288 DPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHF 352
            .|.:|..|.|||.|..|::|:.:..|...:.:|:|||...:.|||:||.||..:::|.|.:|...
  Fly   248 VPGDFLTLAHGDLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQ 312

  Fly   353 DFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNF 417
            ...::.|...|...|..:.::|..|||...|:.......:..|.::...|.:.....:.|:.|..
  Fly   313 PELVQFYYYKLNAALKKVQYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMTYTGKEEASMDQI 377

  Fly   418 MSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLEV 456
            :|.|..|:.|:...:..:..::.:...||:||:.|.|:|
  Fly   378 ISLSEKGMRFKDDAFQAEETRKKMRLTLPFLDHLGLLDV 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 79/301 (26%)
EcKinase 516..800 CDD:281023
CG11891NP_001027211.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.