DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG7135

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster

Alignment Length:307 Identity:74/308 (24%)
Similarity:155/308 (50%) Gaps:15/308 (5%)


  Fly   514 TKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFER 578
            |:.|:|:.|.:.:.:|:.:..::.....|.|:|...|......:..:::.||...|....|..|.
  Fly    41 TRGGENYCSNIYRAQIKYRNAESCAMETSLIVKSMPDEKQAILARLHIYNKETLFYMHIKPKLEA 105

  Fly   579 FY---KDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWH 640
            ..   .|.....|.:||.: .|....::.::||:|..:|:::..|.:|:|.:|:...:.|||::|
  Fly   106 LMWRAVDSFSAWTLAPKHY-YSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYH 169

  Fly   641 AASLKYKELNG-------PYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKM 698
            |.::...|...       |:...:.:.|.:|....:| |..:....:.:.:...|.|:...|::.
  Fly   170 ALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKLLF-GTQLLKLAALVGDCEGFGGITTKLYRY 233

  Fly   699 PEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDL 763
            .|   .:.:|:|:.........|||||||.|:|||.|:|:::..|::..::|.|:..||:...|:
  Fly   234 HE---HFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDI 295

  Fly   764 YYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKEL 810
            .||:.:|.:|::..|:...|:..|::::.:..|.|.::..:||.:::
  Fly   296 NYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDI 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 71/294 (24%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 70/292 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55194
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.