DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31300

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster

Alignment Length:422 Identity:105/423 (25%)
Similarity:187/423 (44%) Gaps:32/423 (8%)


  Fly    47 PKWLNQTQFEELLAADVDQFS-KIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMK 110
            |.|||:...||:|:|..|... |:|..::.||.|.|::||::|.|.:.:.............:..
  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKA 82

  Fly   111 VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIK-FAPRAFKLDATKEPKVANTV 174
            :|......:.|:|.::.|.:|...|.::||:.|.:.:..|.|.| |.|..:.   :.||:  ..:
  Fly    83 MPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYH---SLEPR--KVM 142

  Fly   175 LMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNNKEAII 239
            :..||...|:..| |...:..|:.|.|..:||::||.....::....:...|..|:.    |...
  Fly   143 IFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLF----EMPT 202

  Fly   240 AFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNE------FNALNHG 298
            ...:..:.:...||:..||:.....:|:...|| :....|:.::..:.:.:|      |..|.||
  Fly   203 VKTDPFITTGMQSFIEMLDRLPELRKYKPHFEK-IKDKYMQRLQAVMKEYHENRKSDAFYVLCHG 266

  Fly   299 DCWMNNLLFKMN-SSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEA 362
            |..:.|::||.| .:|..||.:.||||........:||.|.|...::.:.:.......|.||...
  Fly   267 DFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTV 331

  Fly   363 LVKHLGILGFTGRKPSLR----ELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSAD 423
            ||..|..:|:.|..|:..    |:|:.  ||..:.|..|.  |||:|...::|...::.:.|.  
  Fly   332 LVATLKSIGYPGELPTQAKLWDEIHKN--KYYDFFLLSTF--LPLILAIKSKSFKVNDLIQDP-- 390

  Fly   424 GVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455
              ..|...|......:.:.::||..:..|:.:
  Fly   391 --ETRQKTYFLDTYVKDVSKLLPKFEQLGYFK 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 72/300 (24%)
EcKinase 516..800 CDD:281023
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 72/300 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55535
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.