DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31975

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster

Alignment Length:429 Identity:109/430 (25%)
Similarity:188/430 (44%) Gaps:63/430 (15%)


  Fly   480 DQIPDWLNIDDFKEIILSAEPNF--EKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTF- 541
            |::|:   |....|::   ||:.  .::|:..:...||||||:.|.||  .|.|:|:.::.::| 
  Fly     4 DKLPE---IRALSEVV---EPHVSGSRLLNYHTSSLTKPGDNYGSVLL--AIHARLQKSNGESFE 60

  Fly   542 -SYILKVHSDNDAINFSDFNLF-PK-----EIEVYSTYVPAFERFYKDVGLPVTFSPKSF----- 594
             ..:.||    ..|:...:..| |:     |..||....||......:.|:|.....|.|     
  Fly    61 EQLVAKV----PPIDPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYG 121

  Fly   595 ---RLSKDVSK----EYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGP 652
               .|..:.||    ..|:||||:.||:....|:...||.|:...||.:|::||.||..:.|.  
  Fly   122 CRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILR-- 184

  Fly   653 YSPKYNNGIFTEQTAPIFKGMFVNT---------KKSFIEEVSKFDGVDEYL-HKMPEILDTYVD 707
              |:    :|.||..|.||....:.         |...:|::.:....|..| .:|.|:.|.:.:
  Fly   185 --PE----VFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFE 243

  Fly   708 RILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQ 772
            .:.......:..|..:.|.|.|||||||:|...|...|..::|.|..:|.:...|:..|::||..
  Fly   244 FLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308

  Fly   773 LDIKVDQFDYLIRWYHQNMKE-----HAKL--LNYNGFIPSLKELHAILIQHPIFAAGTVLTTLS 830
            ..|...:|::::..|::..:.     .|||  ..:..|...:|.:..|.:.|.||....:|...:
  Fly   309 TAILEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSA 373

  Fly   831 MCLNKTTDD--FTTDSF--LGNEENGKSLREAMFSNERY 865
            :..:...::  ..||..  .|:|...:.|.:.:...|::
  Fly   374 LIGDSEAEERPKLTDVLKNTGSERISRKLSQILNLAEKF 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 87/321 (27%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 84/313 (27%)
APH <214..329 CDD:279908 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59370
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.