DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and Y45G12C.4

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_503696.1 Gene:Y45G12C.4 / 189933 WormBaseID:WBGene00021567 Length:431 Species:Caenorhabditis elegans

Alignment Length:467 Identity:92/468 (20%)
Similarity:158/468 (34%) Gaps:163/468 (35%)


  Fly   487 NIDD---FKEIILSAEPNF---EKILSSTSKLATK-----------------PGDNFASKLLKV- 527
            ||.|   |:..|...||::   ||..:..||.|.|                 .|:.|..:.||. 
 Worm    55 NISDLKGFQSKIALIEPDWVGAEKNQNLPSKFAVKISTQLAFAVFSKITKFDGGNGFGEEKLKFL 119

  Fly   528 ----------EIEA-----QLKDNSV-KTFSYILKVHSDN-DAINFS--DF--NLFPKEIEVYST 571
                      |:||     :|....: .|.:|.||...|. |...|.  ||  |:.|  :.:|.:
 Worm   120 GKFIREGHNREVEAYKLLEKLNHPDIPHTKAYYLKPFKDKFDLKGFMILDFVPNVHP--MPMYES 182

  Fly   572 YVPAFERF--------YKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEH 628
             :||.:..        :...|..:|...:||....|:.:  |:.|.:.|.  :.::|:.|:    
 Worm   183 -IPADDLISLVRGVATFAGHGESLTAEQRSFARGSDIFE--LMFEEMYPD--EQLERVCGV---- 238

  Fly   629 SKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDE 693
                                :...:..|  |....|:...:| .::.|:.||:            
 Worm   239 --------------------IQATFGAK--NPAVVEECIKLF-WIYKNSIKSY------------ 268

  Fly   694 YLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGN 758
              .|:.|:|...:               ||||||.|.:|::...:..|.:....::|.|......
 Worm   269 --SKVSELLGFKL---------------VLNHGDLWQSNMLHCLDEHGNLVLKAIIDWQGVSMLP 316

  Fly   759 PAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIP----SLKELH-AILIQHP 818
            |..||...:|.......:.::...|:..|||         .:.|.:.    ||:||. :..:.:|
 Worm   317 PGLDLARLLMGCLTAYERRERGAELLMLYHQ---------TFTGIVGEELFSLEELQDSYNLYYP 372

  Fly   819 IFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANIERVMPWINRRG--- 880
            |.    .||.:.|.                        .::|.|.. .:.:|:....:...|   
 Worm   373 IM----TLTLVPMV------------------------SSLFENSE-MSEVEKTQARLKTEGKLF 408

  Fly   881 -LLDNFANGHSQ 891
             ||::....|.|
 Worm   409 ALLEDLVKVHEQ 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 61/314 (19%)
Y45G12C.4NP_503696.1 DUF1679 16..422 CDD:285194 92/468 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.