DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and T16G1.6

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans

Alignment Length:447 Identity:98/448 (22%)
Similarity:175/448 (39%) Gaps:114/448 (25%)


  Fly   488 IDDFKEIILSAEPNFEKILSSTSK-LATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILK----- 546
            :.|.:|.| ..:.|.|..|...:| .....|:.|.|:::.||.|..:.:|.:.. .:|||     
 Worm    22 VKDVQEAI-GEQMNTESRLGENTKYTVVGDGNGFMSRVVLVEPEWTITENHLPK-KFILKICSSL 84

  Fly   547 -VHSDNDAINFSDFNLFPKEIEVYST---------------YVPAFERFYKDVGLPVTFSPKSFR 595
             ||...|.:..|:.::...|.|:::.               ||.| |::.|...|   .:.|.| 
 Worm    85 HVHGIVDKMKESNQSINENEEELWAMFENEAQHLHNREVNFYVLA-EKWNKPEEL---LNAKIF- 144

  Fly   596 LSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKC---------TLKKLAQWHAASLKYKELNG 651
            .||....|..|      .||..::.:..:.:.|..|         .||.:||..|.||   .|:.
 Worm   145 FSKKFDSENKL------KGFLGMEYVDDVTIRHLYCNLKPYELHPVLKAVAQLQAESL---HLSD 200

  Fly   652 PYSPKYNNGIFTEQTAPIF-----KGMFVNTK--------------KSFIEEVSKFDGVDEYLHK 697
            ......:...|.:....:|     ||.:..|:              ::|..||..|    |:...
 Worm   201 EELQSISGFDFKQMMGTMFNDDGLKGNYKQTRDINPERLKEKTDIVEAFGMEVVNF----EFAGN 261

  Fly   698 MPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQD 762
            :.:::..:.|              ||.|||.|..||::. |:||:...:.::|:|:...||||:|
 Worm   262 LNKVVGIHKD--------------VLVHGDLWAANILWN-ENDGKFSASKVIDYQIIHMGNPAED 311

  Fly   763 LY-YFIMSSTQLDIK------VDQF-DYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPI 819
            |. .|:.:.:..|.:      ::|| :|.:.....|...:.        :..|||.:.:     .
 Worm   312 LVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDNEIPYT--------LDQLKESYRL-----Y 363

  Fly   820 FAAGT-VLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANIERVMPW 875
            |..|: |:..|...:.:|...::.|:     |:.:..||.:  .|:....:|.:..|
 Worm   364 FVTGSLVMLPLYGPIAQTKLSYSKDT-----EHVEEYREIL--TEKAEKLLEDMEHW 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 76/341 (22%)
T16G1.6NP_506234.2 DUF1679 8..418 CDD:285194 98/448 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.