DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and E02C12.9

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:348 Identity:69/348 - (19%)
Similarity:126/348 - (36%) Gaps:119/348 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 DWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVH 548
            ||::::                          .|.|..||.....::..:.:|.:|.|..:    
 Worm    59 DWVDVE--------------------------KGKNVPSKFAVYGLKKFIDENDMKGFLIV---- 93

  Fly   549 SDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPS 613
                     ||.....::.:|.: :||.|......|:. |||....:|| |..|::       ..
 Worm    94 ---------DFVSNAHDVGMYLS-IPADELIPLVRGIS-TFSALGEKLS-DNEKKF-------AG 139

  Fly   614 GFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTK 678
            |...::||                               :|..:|:....:.    |:||:...:
 Worm   140 GSDFLERM-------------------------------FSQLFNSSSLQKH----FQGMYSVFE 169

  Fly   679 KSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINE-QAF-NVLNHGDAWINNIMFQYESDG 741
            |   |:..:.||:.|......::|..|       .||:| ..| :||||||.|.:|::...|::|
 Worm   170 K---EKYYQVDGLIETFVVYQKLLKKY-------TKISELLGFKSVLNHGDLWQSNMIHSMENNG 224

  Fly   742 RVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYH--------------QNMK 792
            ::|...::|.|.|....|..|....|:.....:.:.::...|:..||              :.::
 Worm   225 KLKLEAIIDWQSTVILPPGLDTAELIVGCLSAEDRREKGHDLLLLYHKTFINVFGSEVFSFEELQ 289

  Fly   793 EHAKLLNYNGFIPSLKELHAILI 815
            :     :||.:.|    :.||||
 Worm   290 D-----SYNLYFP----MAAILI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 60/299 (20%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 69/348 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.