| Sequence 1: | NP_650103.1 | Gene: | CG6830 / 41408 | FlyBaseID: | FBgn0037934 | Length: | 891 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510235.2 | Gene: | C29F7.2 / 181463 | WormBaseID: | WBGene00007811 | Length: | 394 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 394 | Identity: | 77/394 - (19%) | 
|---|---|---|---|
| Similarity: | 136/394 - (34%) | Gaps: | 123/394 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   477 ENTDQIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTF 541 
  Fly   542 SYILKVHSDNDAINFSDFNLFPK--------------------------------EIEVYST--- 571 
  Fly   572 YVPAFERF-YKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKK 635 
  Fly   636 LAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMP- 699 
  Fly   700 -EILDTYVDRI----------LEDAKINEQAFNVLNHGDAWINNIMFQYESD--GRVKETLLLDH 751 
  Fly   752 QVTKYGNPAQDLYYFIMSSTQLDIKVD--------QFDYL----------IRWYHQNMKEHAKLL 798 
  Fly   799 NYNG 802 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6830 | NP_650103.1 | EcKinase | 80..372 | CDD:281023 | |
| EcKinase | 516..800 | CDD:281023 | 64/351 (18%) | ||
| C29F7.2 | NP_510235.2 | CHK | 142..321 | CDD:214734 | 41/205 (20%) | 
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2AMXB | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||