DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and C29F7.2

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans

Alignment Length:394 Identity:77/395 (19%)
Similarity:136/395 (34%) Gaps:123/395 (31%)


  Fly   477 ENTDQIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTF 541
            ||.....:||     .|||       ||      |:..||         |:.....|.::.:...
 Worm     7 ENIPLTKEWL-----AEII-------EK------KIGVKP---------KIGTSGILDNSELGYM 44

  Fly   542 SYILKVHSDNDAINFSDFNLFPK--------------------------------EIEVYST--- 571
            |.|.||....||.:.......||                                |:.:::|   
 Worm    45 SMIRKVQLHFDAEHEESHPNLPKHVVLKIACSSKGTGVLDSAGADMTETDHSANVELFMHNTECN 109

  Fly   572 YVPAFERF-YKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKK 635
            |...|.:. .|.:.|||.::..... .|:.....:::|..:..  |:.|.:.|.:.|.....:.:
 Worm   110 YYKIFAKLTEKPLHLPVIYAAIKAE-DKEAPVPVIVMEMFEDC--KVYDIITGFNEEQLYKIVDE 171

  Fly   636 LAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMP- 699
            :.:.|..||.                 ||:...|....||.....:.:  :...|:.|.|.:.| 
 Worm   172 IVKLHIFSLT-----------------TEEWKTIVPDAFVLEMAGYFQ--TMVAGIGEKLAQQPG 217

  Fly   700 -EILDTYVDRI----------LEDAKINEQAFNVLNHGDAWINNIMFQYESD--GRVKETLLLDH 751
             |::.||:...          :.|..:.|:..:||.|||.|...|::....|  |      ::|.
 Worm   218 LELVSTYIKNTFATDPKFLQNINDEYLEERRISVLTHGDLWAPQILWDKNDDIAG------IIDW 276

  Fly   752 QVTKYGNPAQDLYYFIMSSTQLDIKVD--------QFDYL----------IRWYHQNMKEHAKLL 798
            |:|..|:|.:|.::.:.:.|.::.:.:        .||.|          :.|..:.::|..|..
 Worm   277 QITHRGSPMEDFHHIMSTCTSVENRKNLTKPLLDYYFDKLSSGLEAKGVKMPWTREEIEEEYKYS 341

  Fly   799 NYNG 802
            ..||
 Worm   342 FING 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 64/352 (18%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 41/206 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.