DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and T16G1.5

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans

Alignment Length:436 Identity:92/437 (21%)
Similarity:170/437 (39%) Gaps:91/437 (21%)


  Fly   486 LNIDDFKEIILSAEPNFEKILSSTSKL-ATKPGDNFASKLLKVEIE-----AQLKDNSVKTFSYI 544
            :.::|. :|::..:.|.:..|...:|| ....|:.|.|:::.||.:     ..|.:..:...:..
 Worm    20 VKLEDI-QILIKEQMNTDSKLGEKTKLTVVGDGNGFMSRVVLVEADWTIPNENLPEKIILKLTSC 83

  Fly   545 LKVH---------------SDNDAINFSDF-----NLFPKEIEVYSTYVPAFERFYKDVGLPVTF 589
            :.||               ...:|..::.|     |:..:|:.:|.    ..|::.|:..|   .
 Worm    84 INVHHLVSQMKEKNPDAFTEQQEAELWAMFEREAQNVHNREVNLYR----ITEKWNKNDAL---L 141

  Fly   590 SPKSFRLSKDVSKEYLLLENLQPS--GFKMVDRMIGMDLEHSKCT---------LKKLAQWHAAS 643
            |||.:...|      ...||....  |.:.||..:   :.|..|.         |:.||...|.|
 Worm   142 SPKIYFYKK------FDCENKTQGVLGMEYVDDAV---VRHLYCNAKPHELHPILQSLATLQAGS 197

  Fly   644 LKY--KELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSK-FDGVDEYLHKMPEILDTY 705
            |..  .|:|......:.:.:....:....|.|:...::...|.::| .|.|        |.|...
 Worm   198 LHLTEDEINSISGYDFKSMVGRMMSEEGMKQMYTRARQINPERLTKPTDAV--------EALGMD 254

  Fly   706 VDRILEDAKINEQA---FNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFI 767
            :........:|:.|   .|||.|||.|..||::: |:||....:.::|:|:...||||:||....
 Worm   255 IVNFEISCHVNKYAGIQKNVLVHGDLWAANILWK-ENDGNCVASKVIDYQLIHMGNPAEDLVRVF 318

  Fly   768 MSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAI------LIQHPIFAAGTVL 826
            :|:.....:...::.|:..:::...|..:.......:..|||.:.:      |...|:|  |.|.
 Worm   319 LSTLSGADRQAHWEKLLEQFYEYFLEALEGNEAPYTLDQLKESYRLYFVGGGLFVMPLF--GPVA 381

  Fly   827 TTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSN-ERYRANIER 871
            ...   |:.:||:          ||.:..||.:... ||...:::|
 Worm   382 QAK---LSYSTDN----------ENVEEYREVLTEKAERLMEDLKR 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 68/326 (21%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:285194 92/437 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.