DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and F59B1.8

DIOPT Version :8

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans

Alignment Length:475 Identity:111/476 (23%)
Similarity:190/476 (40%) Gaps:106/476 (22%)


  Fly   456 VSTDPLPPELLAALKPQQPQPENTDQIPDWLNIDDFKEII---------LSAEPNFEKI-----L 506
            :||.|     |:.|:|      .|......:.::|..:.|         |:||...|.|     .
 Worm     1 MSTKP-----LSILQP------GTGLFNTHVTLEDVNKAIKEQMSTESELTAESKMEVIGEGNGF 54

  Fly   507 SSTSKLA----TKPGDNFASKLLK-----VEIEAQL-----KDNSVKTFSYILKVHSDNDAINFS 557
            ||...|.    |.|..:...||:.     |.::..|     :.|||.:......||:..:.....
 Worm    55 SSCVILITCHWTIPSSHLPKKLILKIVSFVHVQGLLNKSNEEGNSVMSPEEEAHVHAHFEKSCQK 119

  Fly   558 DFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMI 622
            ..||   |:|    :..||... :.:.||..|..:.|. ..:.:|.::.:|.::.|..:.....:
 Worm   120 GHNL---EVE----FCEAFGHL-EGLLLPKVFFSQKFE-EDNPNKGFVGMEFVEGSVVRHCYENV 175

  Fly   623 GMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNG-IFTEQTAPI-----FKGMF---VNTK 678
            .:|  ..:..||.||:..|.||..:...     ..:|| .|.|....:     .||:|   .|..
 Worm   176 TVD--ELQPILKALARLQALSLSTESCR-----NLDNGEAFEESLMDMLSEDGLKGIFDQSRNID 233

  Fly   679 KSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRV 743
            :...|:|.:.    |..||  |||:  ::.:|...|:......|:.|||.|..||::. ::||..
 Worm   234 QKLSEKVERI----EQNHK--EILN--LETVLNLNKVVGIDQKVICHGDLWAANILWT-QTDGGF 289

  Fly   744 KETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLK 808
            ....:||:|.:..||||:||...::|:.....:...:::::..::....:.   :..|....:|:
 Worm   290 IADKVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDE---IGSNNAPYTLE 351

  Fly   809 ELH-AILIQHPIFAAGTVLTTLSMCLNKTTDDF--TTDSFLGNEENGKSLREAMFSNERY-RANI 869
            :|. :..:..|:.|    ||.:|:        |  ..|..|...|:||:        |.| |..|
 Worm   352 QLKTSFKLYFPVGA----LTLISL--------FGPAVDMKLQGMESGKA--------ENYRRIVI 396

  Fly   870 ERVMPWINRRGLLDNFANGH 889
            |:|      ..|||:..|.|
 Worm   397 EKV------DCLLDDVLNFH 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 68/303 (22%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:285194 107/464 (23%)
APH 124..338 CDD:279908 56/236 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.