DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Elp1 and IKI3

Sequence 1:NP_001262478.1 Gene:Elp1 FlyBaseID:FBgn0037926 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_013488.3 Gene:IKI3 SGDID:S000004376 Length:1349 Species:Saccharomyces cerevisiae

Alignment Length:1305 Identity:353/1306 (27%)
Similarity:584/1306 (45%) Gaps:225/1306 (17%)


  Fly    44 YAVQESGDVRLKVI--ADLPDIVGVEFLQLDNAICVASGAGEVILVDP-QTGATSEGTFCDVGIE 105
            :.:|...|..|..:  ||:..:|.| |.|.|    :.:...:.:.:|| :|.....||. |.||.
Yeast    88 FNIQTFDDKLLSFVHFADINQLVFV-FEQGD----IITATYDPVSLDPAETLIEIMGTI-DNGIA 146

  Fly   106 SMAWSPNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGS----- 165
            :..||.::|.:|.||:..|||:::..|:.|:|..|:.:.....:.|.||||||||||.|.     
Yeast   147 AAQWSYDEETLAMVTKDRNVVVLSKLFEPISEYHLEVDDLKISKHVTVGWGKKETQFRGKGARAM 211

  Fly   166 EGKQAAKQKES--------DST--FIRDEQELNQFTPQDVSISWRGDGEFFVVSYV--------- 211
            |.:..|..|.|        |.|  ::.|..::......:::||||||.::|.||.|         
Yeast   212 EREALASLKASGLVGNQLRDPTMPYMVDTGDVTALDSHEITISWRGDCDYFAVSSVEEVPDEDDE 276

  Fly   212 -AAQLGRTFKVYDSEGKLNHTAEKSANLKDSVVWRPTGNWIAVPQQ-----FPNKSTIALFEKNG 270
             .:...|.|:|:..||:|:..:|....::..:.|:|.|:.||..|:     ..:...:..||:||
Yeast   277 TKSIKRRAFRVFSREGQLDSASEPVTGMEHQLSWKPQGSLIASIQRKTDLGEEDSVDVIFFERNG 341

  Fly   271 LRHREL--VLPFDLQEEPVVQLRWSEDSDILAIRTCAKEEQRVYLYTIGNYHWYLKQVLIFEQAD 333
            |||.|.  .||.|   |.|..:.|:.:|:.||:...    .|:.|:|..||||||||.|   .|.
Yeast   342 LRHGEFDTRLPLD---EKVESVCWNSNSEALAVVLA----NRIQLWTSKNYHWYLKQEL---YAS 396

  Fly   334 PLALLHWDTRCGAEHTLHVLKESGKHLVYRWAFAV---------DRNNSIVGVIDGKRLLLTDFD 389
            .::.:.|...  .:.|| :..::|...:..:|:.:         |...|:  |:||:.:.:|...
Yeast   397 DISYVKWHPE--KDFTL-MFSDAGFINIVDFAYKMAQGPTLEPFDNGTSL--VVDGRTVNITPLA 456

  Fly   390 EAIVPPPMSKIVLKFETYINAFISHGTSLWVYTC--DRKIY--LNEHIHTLG-----KELQK--- 442
            .|.|||||         |...|.:.|..|.| .|  ..:||  :|:.:....     :|::|   
Yeast   457 LANVPPPM---------YYRDFETPGNVLDV-ACSFSNEIYAAINKDVLIFAAVPSIEEMKKGKH 511

  Fly   443 PIML--MPDAELSG-------------------LHLANLTHFSPHYLLATHSSAGSTRLLLLSYK 486
            |.::  .|.:|.:.                   |...||:..:   ||........|.:.::...
Yeast   512 PSIVCEFPKSEFTSEVDSLRQVAFINDSIVGVLLDTDNLSRIA---LLDIQDITQPTLITIVEVY 573

  Fly   487 D------NDNKPGEWFYRVHS----SVRINGLVNAVAVAPYAMNEFYVQTVNNGHTYEVSLKADK 541
            |      :|.......|....    .:...|.:..:...|..:.:|.|:.|:|     .|.:.|.
Yeast   574 DKIVLLRSDFDYNHLVYETRDGTVCQLDAEGQLMEITKFPQLVRDFRVKRVHN-----TSAEDDD 633

  Fly   542 TLKVERSYVQLHEPADQIDWVIVKGCIWDGYTGALVT--LRNQHLLHIDGYRIGEDVTSFCVVTN 604
            .                          |...:..||.  :.|...|..:...:...|||..:..:
Yeast   634 N--------------------------WSAESSELVAFGITNNGKLFANQVLLASAVTSLEITDS 672

  Fly   605 YLVYT---------QLNAMHFVQL-------DDRRQVASRNIERGAKIVTAVARKARVVLQLPRG 653
            :|::|         .||:..|..|       :|.|   .|.||||:.:|:.:..|:.||||..||
Yeast   673 FLLFTTAQHNLQFVHLNSTDFKPLPLVEEGVEDER---VRAIERGSILVSVIPSKSSVVLQATRG 734

  Fly   654 NLEAICPRVLVLELVGDLLERGKYQKAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQW 718
            |||.|.||::||..|...:...:|::|..:.|..||||:|:.|:..:.|:.::..|:|.|....:
Yeast   735 NLETIYPRIMVLAEVRKNIMAKRYKEAFIVCRTHRINLDILHDYAPELFIENLEVFINQIGRVDY 799

  Fly   719 LCLFLSELQNEDFTKGMYSSN-YDA-SK------------QTYPSDYRVDQKVEYVCRLLEQQMN 769
            |.||:|.|..:|.||..|... |.. ||            |.|......|.|...|.::.:..:|
Yeast   800 LNLFISCLSEDDVTKTKYKETLYSGISKSFGMEPAPLTEMQIYMKKKMFDPKTSKVNKICDAVLN 864

  Fly   770 RFVS------RFRLPLITAYVKLG--CLEMALQVIWKEQQEDASLADQLLQHLLYLVDVNDLYNV 826
            ..:|      ::...:||||....  .|..||::|  .:.|::...|..:.:|.:|.|||.:|..
Yeast   865 VLLSNPEYKKKYLQTIITAYASQNPQNLSAALKLI--SELENSEEKDSCVTYLCFLQDVNVVYKS 927

  Fly   827 ALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPIDYRKFRIDDHLKRYTSALSHLAACGEQH- 890
            ||..||..|.|.||||||.||:|:||:|.:|:......|||.|||:|..|..||.||:...:.. 
Yeast   928 ALSLYDVSLALLVAQKSQMDPREYLPFLQELQDNEPLRRKFLIDDYLGNYEKALEHLSEIDKDGN 992

  Fly   891 -YEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYADHLRAIAKLDNASLMYERGGQLQQALLS 954
             .||.::|:..|.||..|||.||...|.|..||..||.||.:.....:|::.||..|:|::|:.:
Yeast   993 VSEEVIDYVESHDLYKHGLALYRYDSEKQNVIYNIYAKHLSSNQMYTDAAVAYEMLGKLKEAMGA 1057

  Fly   955 AKHTLDWQRVLVLA-KKLSEPLDQVAQSLVGPLQQQGRHMEAYELVKEHCQDRKRQFDVLLEGHL 1018
            .:....|:..:.:| :|..|.::.||:.|:..|..:.|:::|.::..|:..:.|....:..:.:.
Yeast  1058 YQSAKRWREAMSIAVQKFPEEVESVAEELISSLTFEHRYVDAADIQLEYLDNVKEAVALYCKAYR 1122

  Fly  1019 YSRA-IYEAGLEDDDVSEKIAPALLAYGVQLESSLQADLQLFLDYKQRLLDIRRNQAKSGEG-YI 1081
            |..| :.....:.|::.|::....|..|..:.:.|.||.:..::.:.|.|  |..:||..|. |.
Yeast  1123 YDIASLVAIKAKKDELLEEVVDPGLGEGFGIIAELLADCKGQINSQLRRL--RELRAKKEENPYA 1185

  Fly  1082 DTDVNLKEVDLLSDTTSLHSSQYSGTSRRTGKT---------FRSSKNRRKHERKLFSLKPGNPF 1137
            ......::.|.:|...|..|:|.|..:|.||||         .|::||:|:.|||....|.|..:
Yeast  1186 FYGQETEQADDVSVAPSETSTQESFFTRYTGKTGGTAKTGASRRTAKNKRREERKRARGKKGTIY 1250

  Fly  1138 EDIALIDALHNHVTKIAQQQ----QPVRDTCKALLQLANAADADPLAAALQREFKTLLQAVDAAL 1198
            |:..|:.::...:.::.|.:    :.|...|:..::        ..|..:|:.|..:|..:.|.:
Yeast  1251 EEEYLVQSVGRLIERLNQTKPDAVRVVEGLCRRNMR--------EQAHQIQKNFVEVLDLLKANV 1307

  Fly  1199 DEIWT 1203
            .||::
Yeast  1308 KEIYS 1312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Elp1NP_001262478.1 IKI3 1..887 CDD:282600 268/970 (28%)
COG5290 13..1207 CDD:227610 353/1306 (27%)
IKI3NP_013488.3 COG5290 18..1348 CDD:227610 353/1306 (27%)
IKI3 18..988 CDD:282600 268/970 (28%)
WD40 repeat 308..352 CDD:293791 15/44 (34%)
WD40 repeat 357..390 CDD:293791 14/37 (38%)
WD40 repeat 398..424 CDD:293791 4/29 (14%)
TPR repeat 1004..1034 CDD:276809 16/30 (53%)
TPR repeat 1039..1063 CDD:276809 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341818368
eggNOG 1 0.900 E1_COG5290
Hieranoid 1 1.000
Homologene 1 1.000 H2699
Inparanoid 1 1.050 370 1.000 Inparanoid score I354
Isobase 1 0.950 0.993157 Normalized mean entropy S3846
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003022
OrthoInspector 1 1.000 T1136350
orthoMCL 1 0.900 OOG5_129360
Panther 1 1.100 LDO PTHR12747
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R390
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.