DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Elp1 and ABO1

Sequence 1:NP_001262478.1 Gene:Elp1 FlyBaseID:FBgn0037926 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_196872.1 Gene:ABO1 AraportID:AT5G13680 Length:1319 Species:Arabidopsis thaliana

Alignment Length:1378 Identity:334/1379 (24%)
Similarity:575/1379 (42%) Gaps:275/1379 (20%)


  Fly     1 MRNLKLRYCKELNAVAHPQHLLL---QPELNGGASDI-----YFVVADNKIYAVQ---------- 47
            |:||||     .:.|  ||::.|   :..:...|.||     :|..:.|.:||:|          
plant     1 MKNLKL-----FSEV--PQNIQLHSTEEVVQFAAYDIDQSRLFFASSANFVYALQLSSFQNESAG 58

  Fly    48 --------------ESGDVRLKVIADLPDIVGVEFLQLDNAICVASGAGEVILVDPQTGATSEGT 98
                          |.||.          |...::|....::.:.:..|.:::.:.::..|....
plant    59 AKSAMPVEVCSIDIEPGDF----------ITAFDYLAEKESLLIGTSHGLLLVHNVESDVTELVG 113

  Fly    99 FCDVGIESMAWSPNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFH 163
            ..:.|::.::.:|..:::..:|....:::||..:.::.|:.|.                      
plant   114 NIEGGVKCISPNPTGDLLGLITGLGQLLVMTYDWALMYEKALG---------------------- 156

  Fly   164 GSEGKQAAKQKESDSTFIRDEQELNQFTPQDVSISWRGDGEFFVVS---YVAAQLGRTFKVYDSE 225
                      :..:..::|:..:|: .....:||||||||::|...   |.:..:.:..|:::|:
plant   157 ----------EVPEGGYVRETNDLS-VNCGGISISWRGDGKYFATMGEVYESGCMSKKIKIWESD 210

  Fly   226 -GKLNHTAEKSANLKDSVVWRPTGNWIAVPQQFPNKS-----TIALFEKNGLRHRELVL--PFDL 282
             |.|..::|.....:..:.|.|:|..||.  .:..||     :||.||:|||......:  |.|.
plant   211 SGALQSSSETKEFTQGILEWMPSGAKIAA--VYKRKSDDSSPSIAFFERNGLERSSFRIGEPEDA 273

  Fly   283 QEEPVVQLRWSEDSDILAIRTCAKEEQRVYLYTIGNYHWYLKQ----------VLIFEQADPLAL 337
            .|. ...|:|:..||:||.....|....:.::...|.||||||          .::::...||.|
plant   274 TES-CENLKWNSASDLLAGVVSCKTYDAIRVWFFSNNHWYLKQEIRYPREAGVTVMWDPTKPLQL 337

  Fly   338 LHWDTRCGAEHTLHVLKESGKHLVYRWAFAVDRNNSIVGVIDGKRLLLTDFDEAIVPPPMSKIVL 402
            :.| |..|.....|          :.|..|| ..:|...|||..::|:|....:::||||....|
plant   338 ICW-TLSGQVSVRH----------FMWVTAV-MEDSTAFVIDNSKILVTPLSLSLMPPPMYLFSL 390

  Fly   403 KFETYIN--AFISHGTS--LWVYTCDRKIYL------NEHIHTLGKELQKPIMLMPDAELSGLHL 457
            .|.:.:.  |:.|..:.  |.|:..|..:..      |......||:....|.....|..|.:||
plant   391 SFSSAVRDIAYYSRNSKNCLAVFLSDGNLSFVEFPAPNTWEDLEGKDFSVEISDCKTALGSFVHL 455

  Fly   458 ANLTHFSPHYLLATHSSAGSTRLLLLSYKDNDNK-PGEWFYRVH------------------SSV 503
            ..|   ..|.||.. |:.||:....||....|.: .|.:...|.                  :|:
plant   456 LWL---DVHSLLCV-SAYGSSHNKCLSSGGYDTELHGSYLQEVEVVCHEDHVPDQVTCSGFKASI 516

  Fly   504 RINGL----VNAVAVAPYAMNEFYVQTVNNGHTYEVSLKADKTL-KVERSYVQLHEPADQ----- 558
            ....|    |.|:|..|...:..:|:           .:..|.| ...||.:.....:|.     
plant   517 TFQTLLESPVLALAWNPSKRDSAFVE-----------FEGGKVLGYASRSEIMETRSSDDSVCFP 570

  Fly   559 --IDWVIVKGCIWDGYTGALVT-LRNQHLLHIDGYRIGEDVTSFC--------VVTNYLVYTQLN 612
              ..||.|......|....|:. |.:...|.|:|..:..:.:||.        |||:.::.|:.:
plant   571 STCPWVRVAQVDASGVHKPLICGLDDMGRLSINGKNLCNNCSSFSFYSELANEVVTHLIILTKQD 635

  Fly   613 AMHFVQ-----------------LDDRRQ----VASRNI-ERGAKIVTAV-ARKARVVLQLPRGN 654
            .:..|.                 :|.||:    ::..|| |||||::..: ..:|.|:||..|||
plant   636 FLFIVDTKDVLNGDVALGNVFFVIDGRRRDEENMSYVNIWERGAKVIGVLNGDEAAVILQTMRGN 700

  Fly   655 LEAICPRVLVLELVGDLLERGKYQKAIEMSRKQRINLNIIFD-HDVKRFVSSVGAFLNDINEPQW 718
            ||.|.||.|||..:.:.|.:.:::.|..:.|:.||:.|:|.| :..:.|:.|..||:..:|....
plant   701 LECIYPRKLVLSSITNALAQQRFKDAFNLVRRHRIDFNVIVDLYGWQAFLQSAVAFVEQVNNLNH 765

  Fly   719 LCLFLSELQNEDFTKGMYSSNYDASKQ-------TYPSDYRVDQKVEYVCRLLEQQMNRFVSRFR 776
            :..|:..::|||.|:.:| ..:..||:       ......:|...::.:.:.||:.:....|| .
plant   766 VTEFVCAMKNEDVTETLY-KKFSFSKKGDEVFRVKDSCSNKVSSVLQAIRKALEEHIPESPSR-E 828

  Fly   777 LPLITAYVKLG--CLEMALQVIWKEQQEDASL-------------ADQLLQHLLYLVDVNDLYNV 826
            |.::|...:..  .:|.:|..| |..:|...|             |::.|:|||:|:|...::..
plant   829 LCILTTLARSDPPAIEESLLRI-KSVREMELLNSSDDIRKKSCPSAEEALKHLLWLLDSEAVFEA 892

  Fly   827 ALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPIDYRKFRIDDHLKRYTSALSHLAACGEQHY 891
            |||.||..|...||..||:|||||||||.:|:.:|.....|:||..|:|:.|||.::.:.|..::
plant   893 ALGLYDLNLAAIVALNSQRDPKEFLPYLQELEKMPESLMHFKIDIKLQRFDSALRNIVSAGVGYF 957

  Fly   892 EEALEYIRKH-GLYTDGLAFYREHIEFQKNIYV--AYADHLRAIAKLDNASLMYERGGQLQQALL 953
            .:.:..|:|: .|:..||....:.   :|.:.|  |:||||....:.::|:..|....:|::|..
plant   958 PDCMNLIKKNPQLFPLGLLLITDP---EKKLVVLEAWADHLIDEKRFEDAATTYLCCCKLEKASK 1019

  Fly   954 SAKHTLDWQRVL---VLAKKLSEPLDQVAQSLVGPLQQQGRHMEAYELVKEHCQDRKRQFDVLLE 1015
            :.:...||..||   .|.|...:.:.::|..|...:...|:..||.::..|:|.|......:|:.
plant  1020 AYRECGDWSGVLRVGALMKLGKDEILKLAYELCEEVNALGKPAEAAKIALEYCSDISGGISLLIN 1084

  Fly  1016 GHLYSRAIYEAGLE--DDDVSEKIAPAL-LAYGVQLESSLQADLQLFLDYKQRLLDIRRN----- 1072
            ...:..|:..|.|.  ||.:|...:.|| .|.|  |.|..:..::....|..|.|.:|:.     
plant  1085 AREWEEALRVAFLHTADDRISVVKSSALECASG--LVSEFKESIEKVGKYLTRYLAVRQRRLLLA 1147

  Fly  1073 -QAKSGEGYIDTDVNLKEVDLLSDTTSLHSSQYSGTSRRTGKTFR------SSKNRR------KH 1124
             :.||.|..:        |||..||.|..||..||.|..|..|.|      ||.|..      :.
plant  1148 AKLKSEERSV--------VDLDDDTASEASSNLSGMSAYTLGTRRGSAASVSSSNATSRARDLRR 1204

  Fly  1125 ERKLFSLKPGNPFEDIALIDALHN-HVTKIAQQQQPVRDTCKALLQLANAADADPLAAALQREFK 1188
            :||...::.|:..|::||:|.|.. .:|...:::  ::.....|:.|.....|..|....:....
plant  1205 QRKSGKIRAGSAGEEMALVDHLKGMRMTDGGKRE--LKSLLICLVTLGEMESAQKLQQTAENFQV 1267

  Fly  1189 TLLQAVDAALDEI 1201
            :.:.||:.|.|.:
plant  1268 SQVAAVELAHDTV 1280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Elp1NP_001262478.1 IKI3 1..887 CDD:282600 249/1035 (24%)
COG5290 13..1207 CDD:227610 329/1367 (24%)
ABO1NP_196872.1 IKI3 1..953 CDD:282600 249/1035 (24%)
WD40 repeat 79..114 CDD:293791 3/35 (9%)
WD40 repeat 119..169 CDD:293791 7/82 (9%)
COG5290 159..1264 CDD:227610 299/1154 (26%)
WD40 repeat 177..219 CDD:293791 14/42 (33%)
WD40 repeat 226..266 CDD:293791 14/42 (33%)
WD40 repeat 277..319 CDD:293791 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2699
Inparanoid 1 1.050 241 1.000 Inparanoid score I1053
OMA 1 1.010
OrthoDB 1 1.010 D180136at2759
OrthoInspector 1 1.000 T192385
orthoMCL 1 0.900 OOG5_129360
Panther 1 1.100 LDO PTHR12747
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.