DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Elp1 and elp1

Sequence 1:NP_001262478.1 Gene:Elp1 FlyBaseID:FBgn0037926 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_689534.5 Gene:elp1 ZFINID:ZDB-GENE-071116-7 Length:1311 Species:Danio rerio

Alignment Length:1399 Identity:437/1400 (31%)
Similarity:686/1400 (49%) Gaps:231/1400 (17%)


  Fly     1 MRNLKLRYCKELNAV-----AHPQHLLLQPELNGGASDIYFVVADNKIYAVQE----SGDV--RL 54
            ||||.|  .|...:|     ..||...::.|    |..:  :||..  :|:.|    :|:|  .:
Zfish     1 MRNLSL--LKRFRSVDLPIPGSPQCFSIRSE----AGTV--LVASE--FAITEYNPQTGEVLNEV 55

  Fly    55 KVIAD--LPD-----IVGVEFLQLDNAICVASGAGEVILVDPQTGATSEGTFCDVGIESMAWSPN 112
            .:.||  ||:     ::.::.|....::|:|:..|:|||.:..|.........|.|:..|.|||:
Zfish    56 SLTADDYLPEDGSGIVLAIQDLPDQESVCLATANGDVILYNLNTSQLECVGSVDSGLTGMTWSPD 120

  Fly   113 QEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGSEGKQAAKQKESD 177
            ||:|...|...::::||..|:.|.|..::.:...:.:|:.|||||||||||||||||||::|.: 
Zfish   121 QELVTLTTGQESIIMMTKDFEPITEVAINQDDFGEDKFITVGWGKKETQFHGSEGKQAAQRKAA- 184

  Fly   178 STFIRDEQELNQFTPQD---VSISWRGDGEFFVVSYVAAQLG-RTFKVYDSEGKLNHTAEKSANL 238
                    |:....|.|   ..|:|||||:||.||.|..|.| |..::::.|..|..|:|....|
Zfish   185 --------EVQPALPWDDRKPRITWRGDGQFFAVSAVCPQTGARKVRIWNRECVLQTTSEVVNGL 241

  Fly   239 KDSVVWRPTGNWIAVPQQFPNKSTIALFEKNGLRHRELVLPFDLQEEPVVQLRWSEDSDILAI-- 301
            :.|:.|:|||:.||..|:.|||.|:...|||||.|.:..|||:..:..|.:|.|:.||.:||:  
Zfish   242 EQSLCWKPTGSLIASTQRHPNKHTVVFMEKNGLLHGDFTLPFEKDQVKVKELLWNSDSTVLAVWA 306

  Fly   302 ---RTCAKEEQRVY--LYTIGNYHWYLKQVLIFEQADPL---ALLHWDTRCGAEHTLHVLKESGK 358
               :....:....|  |:|:.||||||||.|.|.: ||:   |.:.||......  ||:|.....
Zfish   307 EDLKPKKNDHPNTYIQLWTVSNYHWYLKQSLHFGK-DPIKAPACVCWDPEKALR--LHILTSGLV 368

  Fly   359 HLVYRWAFAVDR-------NNSIVGVIDGKRLLLTDFDEAIVPPPMSKIVLKFETYINAFISHG- 415
            ...|.|.::..|       :|:.|.||||.::|:|.|.:.::||||....|:....:|....|. 
Zfish   369 SCTYDWGWSTQRSHGLDCHDNANVAVIDGDKVLVTTFRQCVIPPPMCAFELQLPVPVNLVTFHSQ 433

  Fly   416 ----TSLWVYTCDRKIYLNEHIHTLG-----------KELQKPIMLMP------DAELSGLHLAN 459
                ..|...|.|.::    |:::.|           |.:..|::|..      |.| ..|.|..
Zfish   434 AQRTNELAALTADGQV----HVYSEGGGTENKAASAFKVVSAPLVLKKTYRVNVDQE-EPLTLRL 493

  Fly   460 LTHFSPHYLLATHSSAGSTRLLLLSYKDNDNKPGEWFYRVHSSVRINGLVNAVAVAPYAMNEFYV 524
            |...|....||.......||||.|:..||.::..  ...:.|.:.::|.|.::.           
Zfish   494 LLWLSEDMFLAVAHGRSMTRLLKLTPSDNQDRKD--MMEIGSDIEVDGHVISLC----------- 545

  Fly   525 QTVNNGHTYEVSLKAD----KTLKVERSYVQLHEPADQIDWVIVKGCIWDGYTG----------- 574
            .::.||   .|:|:.:    :.|.::.|...:.|              |...||           
Zfish   546 HSLKNG---TVALQLEDGQIQKLLMDSSGPSVTE--------------WKDSTGNTINFPQPCVQ 593

  Fly   575 -ALVTLRNQHL---------LHIDGYRIGEDVTSFCVVTNYLVYTQLNAM-HFVQLD-------- 620
             ||.||..:..         |.|....:..:::||.|...:|:.|..:.| |.::|.        
Zfish   594 MALCTLSEEEYFIGLTERSHLFIGDSLVASNISSFVVYDEFLLLTTHSHMCHCLRLSMLSVKGIQ 658

  Fly   621 -------DRRQVASRNIERGAKIVTAVARKARVVLQLPRGNLEAICPRVLVLELVGDLLERGKYQ 678
                   ::.....|.:|||::|||.|.:..|::||:||||||.|..|.|||..:...|:..:::
Zfish   659 SALSSDANQNDETVRKVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDGLRFR 723

  Fly   679 KAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQWLCLFLSELQNEDFTKGMYSSNYDAS 743
            .|.|..||.|||||:|:||:...|:.::..||..|:....:.|||:||:.||.|..||..     
Zfish   724 DAFECMRKLRINLNLIYDHNPTVFLDNIEIFLKQIDSINHINLFLTELKEEDTTTTMYPC----- 783

  Fly   744 KQTYPSDYRV---DQKVEYVCRLLEQQMNRF-VSRFRLPLITAYVKLGC--LEMALQVIWKEQQE 802
                ||...|   .:||:.||..|...|... ..::.|.::|::|:...  ||.|||.:.:.:..
Zfish   784 ----PSHSAVGKEGKKVDVVCDALRSTMETLDPQKYCLCILTSHVRKTTPELETALQKVHELRVN 844

  Fly   803 -----DASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPI 862
                 .:..|::.|::||:||:||:||..:||||||.|||.||:||||||||:||:||.||.|..
Zfish   845 PPGGTSSVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLEP 909

  Fly   863 DYRKFRIDDHLKRYTSALSHLAACGEQHYEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYAD 927
            :|:::.||.|||||..||.||:.|||:|:.|.|..::...||:|.|..|....:..|.:.||||:
Zfish   910 NYQRYTIDKHLKRYRKALHHLSKCGEEHFTEMLNLVKDQRLYSDALELYPSGSQQYKTLSVAYAE 974

  Fly   928 HLRAIAKLDNASLMYERGGQLQQALLSAKHTLDWQRVLVLAKKLSEPLDQ---VAQSLVGPLQQQ 989
            :|....:.:.|.|:..|.|:..:||.:......|:..|.:|.::..|..|   :|:.|...|.:.
Zfish   975 YLVEQQQAEQAGLLLWRCGESTRALQAFVSCTSWRNALAVAAQIPLPPQQLALLARDLAEKLLEA 1039

  Fly   990 GRHMEAYELVKEHCQDRKRQFDVLLEG----------HLYSRAIYEAGLEDDDVSEKIAPALLAY 1044
            .||.||...::::.:|.:.....|::|          :||:|        .|.:...:.||||..
Zfish  1040 RRHTEAALCLEQYAKDCEEAISALIQGAAWEEALRLIYLYNR--------QDIIETDLKPALLEA 1096

  Fly  1045 GVQLESSLQADLQLFLDYKQRLLDIRRNQAKSG-EGYIDTDVNLKEVDLLSDTTSLHS-----SQ 1103
            .....|.|::...||:.:|.||..:|..:||:. |.:.:...:..:.:|.|:.:|:.:     |:
Zfish  1097 HSNQTSFLESQKALFIRHKNRLSVVRELKAKASLELFGEDGPDCADAELYSEASSVMTGSHLGSK 1161

  Fly  1104 YSGTSRRTGKTFRSSKNRRKHERKLFSLKPGNPFEDIALIDALHNHVTKIAQQQQPVRDTCKALL 1168
            ||.::.|...  ||||||||.|.|..|||.|:|||||||::||...:|.:.:.::.|....|||:
Zfish  1162 YSRSNSRISS--RSSKNRRKAEGKKHSLKEGSPFEDIALLNALTQIITVVDKMREEVHSLLKALV 1224

  Fly  1169 QLANAADADPLAAALQREFKTLLQAVDAALDEIWTPELRGNGLMADHLTGPN--VDYL------- 1224
            ..    ..|..|:||||::..||..:|.::.:||:..|:..   .:.|||||  |:.:       
Zfish  1225 LF----QFDDAASALQRDYSDLLLLMDKSIPDIWSENLQPG---QNTLTGPNSTVNSIVASFQQQ 1282

  Fly  1225 --ALQKEQRYALLSPLKRFKPQLIMMDWQHEILQ 1256
              |:.::...||..|..|..     :.|:..||:
Zfish  1283 KPAVPQQDTEALAPPKMRNS-----VKWKLNILK 1311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Elp1NP_001262478.1 IKI3 1..887 CDD:282600 320/999 (32%)
COG5290 13..1207 CDD:227610 417/1326 (31%)
elp1XP_689534.5 IKI3 1..934 CDD:282600 320/999 (32%)
COG5290 71..1255 CDD:227610 401/1254 (32%)
TPR repeat 962..993 CDD:276808 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341798544
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H2699
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D112285at33208
OrthoFinder 1 1.000 FOG0003022
OrthoInspector 1 1.000 T1053355
orthoMCL 1 0.900 OOG5_129360
Panther 1 1.100 LDO PTHR12747
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.