DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Elp1 and Elp1

Sequence 1:NP_001262478.1 Gene:Elp1 FlyBaseID:FBgn0037926 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_543175.1 Gene:Elp1 RGDID:620072 Length:1331 Species:Rattus norvegicus

Alignment Length:1391 Identity:431/1392 (31%)
Similarity:690/1392 (50%) Gaps:195/1392 (14%)


  Fly     1 MRNLKLRYC---KELNAVAHPQHLLLQPE----LNGGASDIYFVVADNKIYAVQESGDVRLKVIA 58
            ||||||...   :::.|...||...|:.|    |.|....:      .::..|::.....:.::|
  Rat     1 MRNLKLHQTLEFRDIQAPGKPQCFCLRAEQGTVLIGSERGL------TEVDPVKKEVKTEISLVA 59

  Fly    59 D--LPD-----IVGVEFLQLDNAICVASGAGEVILVDPQT------GATSEGTFCDVGIESMAWS 110
            :  ||:     |||::.|....::|||:.:|:||:.:..|      |..:.      ||..|:||
  Rat    60 EGFLPEDGSGCIVGIQDLLDQESVCVATASGDVIVCNVSTQQLECVGNVAS------GISVMSWS 118

  Fly   111 PNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGSEGKQ---AAK 172
            |:||::...|....:::||..::||.||.:..:...:.:|:.||||.|:||||||||:.   ..:
  Rat   119 PDQELLLLATAQQTLIMMTRDYEVITEQQIHQDDFGEGKFITVGWGSKDTQFHGSEGRPITFPVQ 183

  Fly   173 QKESDSTFIRDEQELNQFTPQDVSISWRGDGEFFVVSYVAAQLG-RTFKVYDSEGKLNHTAEKSA 236
            ..||..::       :...||   |:|||||:||.||.|.:|.| |..:|::.|..|..|:|...
  Rat   184 MHESALSW-------DDHRPQ---ITWRGDGQFFAVSVVCSQTGARKIRVWNREFALQSTSESVP 238

  Fly   237 NLKDSVVWRPTGNWIAVPQQFPNKSTIALFEKNGLRHRELVLPFDLQEEPVVQLRWSEDSDILAI 301
            .|..|:.|:|:|:.||..|..||:..:..||||||.|....|||...|..|..|.|:.||.:||:
  Rat   239 GLGPSLAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGYFTLPFLKDEVKVNDLLWNADSSVLAV 303

  Fly   302 --RTCAKE-----EQRVYLYTIGNYHWYLKQVLIFEQA--DPLALLHWDTRCGAEHTLHVLKESG 357
              ....||     :..|.|:|:|||||||||.|.|...  :.:..|.||......  ||||.:..
  Rat   304 WLEDLPKEGSSTLKSYVQLWTVGNYHWYLKQSLPFSTTGKNQIVSLLWDPVTPGR--LHVLCQGW 366

  Fly   358 KHLVYRWAFAVDRN--NSI-----VGVIDGKRLLLTDFDEAIVPPPMSKIVLKFETYIN------ 409
            ::|...|.:..||:  ||.     |.||||.::|:|.|...:.||||....|.....:|      
  Rat   367 RYLCCDWHWTTDRSSGNSADDLANVAVIDGNKVLVTVFQRTVTPPPMCTYRLLIPHPVNQVMSSA 431

  Fly   410 ------AFISHGTSLWVYTCDRKIYLNEHIHTLG-------------KELQKPIMLM-----PDA 450
                  |.:.....:.||.||.|..::..: .||             ..|:|...:.     .:.
  Rat   432 HLGNDLAVLDASNQISVYKCDDKPDMDSTV-KLGAVGGTGFKVPLRTPHLEKRYRIQFGNKEEEE 495

  Fly   451 ELSGLHLANLTHFSPHYLLA---THSSAGS-TRLLLLSYKDNDNKPGEWFYRVHSSVRINGLV-- 509
            ::|.|....||.......||   :|||..| ...|.::..:.|.:.|:  ..|.|||.::|:|  
  Rat   496 DVSPLQFRFLTWIEGDAFLAISHSHSSPQSIIHHLTMAGSEGDEEQGQ--LNVSSSVTVDGVVIG 558

  Fly   510 ---------NAVAVAPYAMNEFYVQTVNNGHTYEVSLKADKTLKVERSYVQLHEPADQIDWVIVK 565
                     :||.:|...:.::..::.::.        .:.....|...|:...|..|::...:.
  Rat   559 LCCCSKTKSSAVQLADGQVLKYLWESPSSA--------VEPWKNSEGRPVRFARPCTQMEAAAIG 615

  Fly   566 G--CIWDGYTGALVTLRNQHLLHIDGYRIGEDVTSFCVVTNYLVYT---------QLNAMHFVQL 619
            |  |:        :.|.::....|:...:..::|||.|..::|:.|         .|:......|
  Rat   616 GEECV--------LGLTDRCRFFINDTEVASNITSFAVCDDFLLVTTHSHTCQCFSLSGASLKML 672

  Fly   620 DD---RRQVAS----RNIERGAKIVTAVARKARVVLQLPRGNLEAICPRVLVLELVGDLLERGKY 677
            ..   ..||.|    |.:|||::|||.|.:..:::||:||||||.:..|.|||..:...|::..:
  Rat   673 QAGLCGSQVPSGEILRKVERGSRIVTVVPQDTKLILQMPRGNLEVVHHRALVLAQIRKWLDKLMF 737

  Fly   678 QKAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQWLCLFLSELQNEDFTKGMYSSNYDA 742
            ::|.|..||.|||||:|.||:.|.|:.:|..|:..|:....|.||.:||:.||.||.||......
  Rat   738 KEAFECMRKLRINLNLIHDHNPKVFLENVETFIKQIDSVNHLNLFFTELKEEDVTKTMYPPPVTK 802

  Fly   743 SKQ--TYPSDYRVDQKVEYVCRLLEQQMNRFVSR-FRLPLITAYVKLGC--LEMALQVIWKEQQE 802
            |.|  |.|.    .:||:.:|..:...|.....| |.|.::|::||...  |::.||.:.:.|.:
  Rat   803 SVQVSTNPD----GKKVDLICDAMRVAMETINPRKFCLSILTSHVKKTTPELDIVLQKVHELQGK 863

  Fly   803 -----DASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPI 862
                 ::..|::.|::||.|||||:|:|.:||||||.|||.||:||||||||:||:||.||.:..
  Rat   864 IPFVPESVSAEEALKYLLLLVDVNELFNHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET 928

  Fly   863 DYRKFRIDDHLKRYTSALSHLAACGEQHYEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYAD 927
            :|::|.||.:||||..||.||:.||.:::.|.|..|:...||.:.|..||......:.:.|||.:
  Rat   929 NYQRFTIDKYLKRYEKALGHLSKCGPEYFTECLNLIKDKNLYKEALKLYRPDSPQYQAVSVAYGE 993

  Fly   928 HLRAIAKLDNASLMYERGGQLQQALLSAKHTLDWQRVLVLAKKLSEPLDQV---AQSLVGPLQQQ 989
            ||......:.|.|::.|.|..::||.:......||:.|.:|.:|....|:|   |::|.|.|.:|
  Rat   994 HLVQELLYEPAGLVFARCGAHEKALEAFLACGSWQQALCMAAQLQMAKDKVAGLARTLAGKLVEQ 1058

  Fly   990 GRHMEAYELVKEHCQDRKRQFDVLLEGHLYSRAIYEAGLED--DDVSEKIAPALLAYGVQLESSL 1052
            .:|.||..:::::..|.:....:||||..:..|:......|  |.:...:.|::|.........|
  Rat  1059 RKHSEAATVLEQYALDYEEAVLLLLEGSAWEEALRLVYKYDRVDIIETSVKPSILEAQKNYMDFL 1123

  Fly  1053 QADLQLFLDYKQRLLDIRRNQAKSGEGYIDTDV-NLKEVDLLSDTTSLH-----SSQYSGTSRRT 1111
            .:....|:.:|.||..:|..:::....::|.:| :.:|.||.|:|:|:.     |.:||.::.|.
  Rat  1124 DSQTATFIRHKNRLKVVRELKSQRPRVHVDHEVAHGRETDLFSETSSIRSGSEMSGRYSHSNSRI 1188

  Fly  1112 GKTFRSSKNRRKHERKLFSLKPGNPFEDIALIDALHNHVTKIAQQQQPVRDTCKALLQLANAADA 1176
              :.||||||||.|||..|||.|:|.|.:||::||    :::.|..:.::|...|:|::....:.
  Rat  1189 --SARSSKNRRKAERKKHSLKEGSPLEGLALLEAL----SEVVQSIEKLKDEVHAILKVLFLFEF 1247

  Fly  1177 DPLAAALQREFKTLLQAVDAALDEIWTPELRGNGLMADHLTGPNV---DYLALQKEQR------- 1231
            :..|..|||.|::.||.:..||.:|||  |.|....:..:.||:.   ..:|..::|:       
  Rat  1248 EEQARELQRAFESTLQLMGTALPDIWT--LTGQQSSSTPVLGPSSTVNSIMASYQQQKTCVPVLD 1310

  Fly  1232 -YALLSPLKRFKPQLIMMDWQHEILQ 1256
             :|.|.|....:.|     |:..:|:
  Rat  1311 AWACLPPKIDQRSQ-----WKLSLLE 1331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Elp1NP_001262478.1 IKI3 1..887 CDD:282600 319/999 (32%)
COG5290 13..1207 CDD:227610 414/1315 (31%)
Elp1NP_543175.1 IKI3 1..953 CDD:282600 339/1065 (32%)
COG5290 71..1275 CDD:227610 410/1308 (31%)
WD40 repeat 112..147 CDD:293791 9/35 (26%)
WD40 repeat 198..231 CDD:293791 16/34 (47%)
TPR 874..1099 CDD:223533 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341811756
eggNOG 1 0.900 E1_COG5290
Hieranoid 1 1.000
Homologene 1 1.000 H2699
Inparanoid 1 1.050 543 1.000 Inparanoid score I1105
OMA 1 1.010
OrthoDB 1 1.010 D112285at33208
OrthoFinder 1 1.000 FOG0003022
OrthoInspector 1 1.000 T1087719
orthoMCL 1 0.900 OOG5_129360
Panther 1 1.100 LDO PTHR12747
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.