DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGRP-LB and pglyrp2

Sequence 1:NP_001247052.1 Gene:PGRP-LB FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio

Alignment Length:217 Identity:73/218 (33%)
Similarity:110/218 (50%) Gaps:21/218 (10%)


  Fly     3 DKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGVATARLLSRSDWGARLPK 67
            :||:|.:.:.|...|..|:.....|.......|                 ..::.|..|||..|:
Zfish   252 EKVAGVLPSQGDAELESLIAKGIKEFVLRYMDC-----------------PSIIPRCIWGAAPPQ 299

  Fly    68 -SVEHFQGPAPYVIIHHSYMPA-VCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYT 130
             .:|....|..::.|||:.:|: .|.:...|.::||.||.|||.:.||.||||||.:|.||.||.
Zfish   300 VPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIGYSFVVGSDGYIYE 364

  Fly   131 GRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAK-NLIAFGVFKGYIDPAYKLLGHRQ 194
            |||:...|||....|:...|:..|||:...||....::..: :|:..||..|::...:.:|||||
Zfish   365 GRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNGFLQEDFTILGHRQ 429

  Fly   195 -VRDTECPGGRLFAEISSWPHF 215
             |..|.|||..|::||::|.|:
Zfish   430 VVVTTSCPGNALYSEITTWMHY 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 55/146 (38%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 55/145 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H49671
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131026
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9951
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.