DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PGRP-LB and Pglyrp4

Sequence 1:NP_001247052.1 Gene:PGRP-LB FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_017446364.1 Gene:Pglyrp4 RGDID:1308520 Length:491 Species:Rattus norvegicus

Alignment Length:172 Identity:64/173 (37%)
Similarity:89/173 (51%) Gaps:5/173 (3%)


  Fly    49 GVATA---RLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLE 110
            |:.||   .::.||.||||.....: ...||.|.||.|: ....|....:|...::|:|.|....
  Rat   322 GIFTAACPHIVPRSAWGARESHCFK-MTLPAKYAIILHT-AGRTCSQPDECRLLIQDLQSFFMDR 384

  Fly   111 RGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIA 175
            ....||||:|.:|.||.:|.|.|:|..|:....|||.::.|..:|.:....|....|.||::||.
  Rat   385 LNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAAALQAAQDLIQ 449

  Fly   176 FGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTH 217
            ..|.|||:.|.|.|:||..|.:|..||..|:..|.:||||.|
  Rat   450 CAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHFKH 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 51/145 (35%)
Pglyrp4XP_017446364.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 1 1.000 FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
44.070

Return to query results.
Submit another query.