DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ranbp9 and KAP120

Sequence 1:NP_001287284.1 Gene:Ranbp9 FlyBaseID:FBgn0037894 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_015200.1 Gene:KAP120 SGDID:S000006046 Length:1032 Species:Saccharomyces cerevisiae

Alignment Length:1179 Identity:211/1180 (18%)
Similarity:423/1180 (36%) Gaps:374/1180 (32%)


  Fly    17 IIEELQNLLSSDTGVLQQTEKRIKQLEYTEGYGVYLSEIIMNQAHELPLRQIAIVMLTRYVENHW 81
            ::|:..|.....:.|.:..|::::|.|...|:...|..|.:|.::.|.:|.:|::.....|:.:|
Yeast    13 VLEQASNPQHIRSDVQKLAEQQLRQWETQAGFHYLLQSIYLNLSNSLQIRWLAVIQFKNGVDKYW 77

  Fly    82 TDDDDVKRKANGCMASEQAKRTIRNILPNGLYDPNSKIRSSVAHTISTIAATDYPHCWAELFDII 146
            .     ..:.|.....|:|  :||..|...:.:.|:::....|...:.||..|:|..|..||:.:
Yeast    78 R-----STRINAIPKDEKA--SIRGRLFEMIDEQNNQLCIQNAQASARIARLDFPVEWPTLFEDL 135

  Fly   147 VKCLGGNEDSIHGAMQVLQDFSYDVEQI-KELG---------------PVVIPEVYRIF------ 189
            ...|  |::.|......:.:....:.|| |.||               |:::|.:.||:      
Yeast   136 ENLL--NDEIIRKDSVKIYNILMHINQIVKVLGTARIGRCRPAMQSKVPLILPLIVRIYLQSFEE 198

  Fly   190 ---DSEQNY----SIKTRVSAIRILKPLFA----------SIAALITNKEEQSTMMSSILTNF-- 235
               .|..||    |::....|:::|:.:..          |:...|........|:.|...||  
Yeast   199 WTTSSNLNYEDLSSLQVSYLALKVLRRIICEGYDRPQTDQSVCDFIKLSVSHFEMLISNHENFKK 263

  Fly   236 ----------MDKLMHYLSMNSGAVSSFLL---RTEIIKVFTHLV-NEMPKYINPFMDRVLPIVW 286
                      :.||  |.::.:|:.::|:|   .|:|:..:|.|: ::.||......|       
Yeast   264 FDIYEKFIKCLGKL--YFNLVTGSPANFILLPCSTQILITYTRLIFDKAPKVYRENSD------- 319

  Fly   287 QLLTQIAETYVKVSVNQTETSPLASGDSEEDDEQTNFQSLII--QILEFIN-------------- 335
                                   .:||..   |||..:.|:|  :::.||:              
Yeast   320 -----------------------VTGDFW---EQTAIRGLLILKRVINFIHKKGAITLKARSDKL 358

  Fly   336 -CILTCNKLRGSI--KNVLADLIYITIV--YIQLSEEQLEDWHDDPEKFVDDEDDGGVELTVRMC 395
             ...:.||:....  :|::..|: .|::  |::|...:||:|..|||::::::.....|..:|.|
Yeast   359 TIDASINKINTEFLNENLITRLV-DTLMEWYLRLRPTELENWFMDPEEWINEQMATSYEYQIRPC 422

  Fly   396 GRDVLLAINDEFGANAIQPLQEALGRHFSVADAEKAANNPNWWKIQEACMDAVHAFRDVILAGDS 460
            ..:|...:.:.|....:..|.:.:..     ||.|.:|:                 .|..|..|:
Yeast   423 AENVFQDLMNTFSELLVPYLLKKIEN-----DASKLSNS-----------------LDDFLRKDA 465

  Fly   461 TFDLLNYLTIVRNLLVHQESPPLVGRALWTLSIYSKSDLYN-PQMLTEIL--DVTLCSLSPEKSH 522
            .:                        |.:.||..:.|::.: .::|.::.  :.|..::|.::..
Yeast   466 IY------------------------ASFQLSASAVSEMVDFDRLLIQVFLPEATNTNISGDELR 506

  Fly   523 ILRISAVRTLNGF--LQANETIDGEKRTLLVSKLPGFLDGIMALVPGSKAAVLALLMEALTFMVK 585
            |:|......:|.:  ::.:|    |.::|.......||..     ...|..:|..:....|.:..
Yeast   507 IIRRRVALIINEWSTVKCSE----ESKSLCYKLFTNFLTD-----EDDKVVLLTTVQTVRTMVDD 562

  Fly   586 FDAEFAFASQAKITPLAIAVFLKYTEDPYVLETVQDLIKALCQRKECLGPLQEKFIPTIVSILGL 650
            ::                  |.|.|..|::.|.|..|::              |.:|::      
Yeast   563 WN------------------FNKDTFQPFLTENVHLLLR--------------KILPSV------ 589

  Fly   651 TGAASTEKQDIALDVLNTIVRYTEPPLNNSLL---------------ETAFPAII-NCVLH---- 695
               :.||.:...|:.|:.|:..|:|.::..||               ..|..||: |.:|.    
Yeast   590 ---SLTETRLYVLNTLSDIIIQTKPLISRDLLVEILQIIPNLWEIATNNASEAILANALLRLLRN 651

  Fly   696 -----------TDDHAVMVAGGEC---------------------LRSFINVSPEQICSYKNGE- 727
                       |.|.|:.|....|                     |::|  .|.:|....|..| 
Yeast   652 LVSSLGSQSHLTWDIAIPVVALACDPSSMQYQLLSEDGYELWGMLLQNF--SSHDQEFDDKFVEL 714

  Fly   728 ------GINCIMQVVATVL---------LNPM-----NSEMTAAGQIGRLVITIITKMGSMLGQN 772
                  ||....:::.|:|         |||:     |:......|:.:.::.:......::.:.
Yeast   715 VPFLKYGIETHTEILPTLLEIIKSYALILNPVDFFSNNTFQDIFKQMSKYLLKLREDSFQLVLEI 779

  Fly   773 VDMLLKAVISKMQNLECLK-----------------------VIMNLVLIFAHLFLTQMDAVLNF 814
            .::|:.:..|..:||...|                       :...::.|.|.:.....||::.|
Yeast   780 WEILILSNESDYENLLLQKFYETGVLSALFDAIFLEEAPSSYLCSQIIQIIARISYVNPDALMTF 844

  Fly   815 LST----VPGPNGEPAM------------------QFVLTNWLSRQNSFFGNYERKVTTMALCKL 857
            |:|    :|..|....|                  ..:||.|:......|....:||..:.:..|
Yeast   845 LATYHDNLPTSNENARMPESIRKIVSKDQTYDSVVNKLLTGWIVCFRDIFDPKFKKVHILGISSL 909

  Fly   858 FEYG---VATQDNRLTTITFKELVDDPTDTRRRTRSVAATTQKW----VTIPALVKIFKVLISEY 915
            ...|   :.|:.:.:.:: :.|::::..:|.|      ...:|:    :.....:....:...:.
Yeast   910 LRTGLVPILTEFSSIASL-WIEMLEEINETNR------GDCEKYHLNDIVTEQSIAFHPLTAEQL 967

  Fly   916 QHFQEGKSDEPLTD-SEEDGDDEDAPGNPDKPRYISDLFESDEDNAEDEQLLQELLKETNYQGDI 979
            ::.|..|:::|:.: |.:|              :||...|..|.:...|: .||.||..|  ..:
Yeast   968 RYHQLCKNNDPVHNISLKD--------------FISQSMEYLESHLGVER-YQEFLKTIN--PSL 1015

  Fly   980 ADNLQKFLT 988
            .:|||.||:
Yeast  1016 LENLQMFLS 1024

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ranbp9NP_001287284.1 SXM1 14..891 CDD:227943 190/1076 (18%)
IBN_N 36..114 CDD:281761 18/78 (23%)
KAP120NP_015200.1 CSE1 8..1023 CDD:227944 210/1177 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.