DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ranbp9 and ipo11

Sequence 1:NP_001287284.1 Gene:Ranbp9 FlyBaseID:FBgn0037894 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_005167213.1 Gene:ipo11 ZFINID:ZDB-GENE-040711-1 Length:975 Species:Danio rerio

Alignment Length:1105 Identity:233/1106 (21%)
Similarity:421/1106 (38%) Gaps:266/1106 (24%)


  Fly    12 SVKQAIIEELQNLLSSDTGVLQQTEKRIKQLEYTEGYGVYLSEIIMNQAHELPLRQIAIVMLTRY 76
            |....:::.|....|.||.||:..|::::|.|...|:...|..|..|...::.:|.:|::.....
Zfish     5 SASSVVLQALTQATSQDTAVLKPAEEQLRQWETQPGFYSVLLSIFNNHLLDVNVRWLAVLYFKNG 69

  Fly    77 VENHWTDDDDVKRKANGCMASEQAKRTIRNILPNGLYDPNSKIRSSVAHTISTIAATDYPHCWAE 141
            ::.:|       |:......||:.|.::|..|.....:|.::|.:.:|..|:.:|..|.|..|.|
Zfish    70 IDRYW-------RRVAPHALSEEEKSSLRAGLITNFNEPVNQIATQIAVLIAKVARLDCPRQWPE 127

  Fly   142 LFDIIVKCLGGNEDSI--HGAMQVLQDFSYDVEQI---------KELGPVVIPEVY--------- 186
            |..|:::.: ..:||:  |.|:...    |.|.:.         :.|...:...:|         
Zfish   128 LIPILLESV-KVQDSLQQHRALLTF----YHVTKTLASKRLATDRRLFQDLASSIYSFACSLWNH 187

  Fly   187 -------RIFDSEQN---YSIKTRVSAIRILKPLFASIAALITNKEEQSTMMSSILTNFMDKLMH 241
                   :|:..:|.   .|::..:.::::|:.|  ::...:..:.....|  ..|....::|..
Zfish   188 HTDSFLQQIYSGDQQTALSSLERTLLSLKVLRKL--TVHGFVDPQNNMEVM--GFLNAVFERLKQ 248

  Fly   242 YL----SMNSGAVSSFLLRTEIIKVFTHLVNEMPKYIN-PFMDRVLPIVWQLLTQIAETYVKVSV 301
            :|    .:..|:.....|...|| :||.::.:..:|.. ||    :|::.:.| :.|.:||    
Zfish   249 FLECCRQVGPGSPCREKLEKTII-LFTKVLLDFLEYHPCPF----IPLIQRSL-EFAVSYV---- 303

  Fly   302 NQTETSPLASGDSEEDDEQTNFQSLIIQILEFINCILTCNKLRGSIKNV--------------LA 352
                        ..|..|...|:..|:|.:..|..|:. |......||:              .|
Zfish   304 ------------FTEAGEGVVFERFIVQCMNLIKMIVK-NDAYKPAKNIEDSKPESLEAHRIKTA 355

  Fly   353 DLIYITIV---------YIQLSEEQLEDWHDDPEKFVDDEDDG-GVELTVRMCGRDVLLAINDEF 407
            ...:.|:.         |..|:||:|..|.:|||.|..:|..| ..:.::|.....:.|.|...:
Zfish   356 FFTHQTLTEIGRRLVSKYFLLTEEELTMWEEDPESFAVEETGGDSWKYSLRPSTEVLFLDIFHNY 420

  Fly   408 GANAIQPLQEALGRHFSVADAEKAANNPNWWKIQEACMDAVHAFRDVILAGDSTFDLLNYLTIVR 472
            .......|.|.:......::.|    :|    :|....|||  :..|.||....||.:::....:
Zfish   421 SQTLTPVLLEMVQNLQGPSNVE----DP----VQMLMKDAV--YNAVGLAAYELFDNVDFDQWFK 475

  Fly   473 NLLV------HQESPPLVGRALWTLSIYSKSDLYNPQMLTEILDVTLCSLSPEKSHILRISAVRT 531
            |.|:      |.....:..|.:|.:..:. |..:.|::...:.:|.| ||..:...::||....|
Zfish   476 NQLLGELQVSHNRYKLIRRRVIWLIGQWI-SVKFKPELRPLLYEVIL-SLMQDPDLVVRIETATT 538

  Fly   532 LNGFLQANETIDGEKRTLLVSKLPGFLDGIMALVPGSKAAVLALLMEALTFMVKFDAEFAFASQA 596
            |...:.     |.|.||  ...|| :|:           ::.:||.:.|..:.:.|.:.......
Zfish   539 LKLAVD-----DFEFRT--EQFLP-YLE-----------SIFSLLFQLLQQVNECDTKMQVLHVI 584

  Fly   597 KITPLAIAVFLKYTEDPYVLETVQDLIKALCQRKECLGPLQEKFIPTIVSILGLTGAASTEKQDI 661
            ......:::.::    |||...|| .:..|.::.|....|:...:.|::.::...||.|......
Zfish   585 SCVIERVSIQIR----PYVGCLVQ-YLPLLWKQSEEHNMLRCAILTTLIHLVQGLGAESKNLYPF 644

  Fly   662 ALDVLNTIVRYTEPP----LNNSL------LETAFPAIINCVLHTDDHAVMVAGGECLRSFINVS 716
            .|.|:......::||    |.:.|      ||.: |||.               .|.||.|.|:|
Zfish   645 LLPVIQLSTDVSQPPHVYLLEDGLELWLVTLENS-PAIT---------------PELLRIFQNMS 693

  Fly   717 PEQICSYKN----GEGINCIMQVVATVLLN-----------PMNSEMTAAGQIGRL-VITIITKM 765
            |....|.:|    .:.||..:.:.||..|.           .:.|::|..||:..| |:.|..|:
Zfish   694 PLLELSSENVRTCFQIINAYIYLSATDFLQNYAEALCRSFCELLSDITNEGQVQVLKVVEIAIKV 758

  Fly   766 GSMLGQNV-DMLLKAVISKMQNLECLKVIMNLVL------------IFAHLFLTQMDAVLNFLST 817
            ..:||.:: ..||.:||..:...|...|:|:..|            .|..| ||||....|    
Zfish   759 SPILGSHMFQPLLPSVIRGIVEGERYPVVMSTYLGVTGRILLQNSGFFTSL-LTQMAVEFN---- 818

  Fly   818 VPGPNGEPAMQFVLTNWLSRQNSFFGNYERKVTTMALCKLFEYGVATQDNRLTTITFKELVDDPT 882
               ...:..:..::..|:.|.::......||::.:||..|.     ..||.:....|..:::   
Zfish   819 ---QEADQLLGSMIEMWVDRMDNITQPERRKLSALALLSLL-----PSDNSVIQDKFCGIIN--- 872

  Fly   883 DTRRRTRSVAATTQKWVTIPALVKI---------FK--VLISEYQHFQEGKSDEPLTDSEEDGDD 936
                            :::.||..:         ||  :|:|   ||:|.|    ||      ||
Zfish   873 ----------------ISVEALHDVMTEDPETATFKDCMLMS---HFEEPK----LT------DD 908

  Fly   937 EDAPGNPDKPRYISDLFESDEDNAEDEQLLQELLK-------ETNYQG-------DIADNLQKFL 987
            |:.|...||.|.:..| |....:...:|.:.|.||       :..:|.       :|...||:|:
Zfish   909 EEPPTEQDKRRKLLAL-EDPVHSVSLQQFVYEKLKAQQMLMGDQGFQALMETVDTEIVRQLQEFI 972

  Fly   988  987
            Zfish   973  972

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ranbp9NP_001287284.1 SXM1 14..891 CDD:227943 202/981 (21%)
IBN_N 36..114 CDD:281761 16/78 (21%)
ipo11XP_005167213.1 CSE1 10..>760 CDD:227944 175/841 (21%)
IBN_N 28..100 CDD:281761 16/79 (20%)
HEAT repeat 515..545 CDD:293787 8/36 (22%)
HEAT repeat 559..586 CDD:293787 4/27 (15%)
HEAT repeat 599..630 CDD:293787 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.