DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ranbp9 and xpo-2

Sequence 1:NP_001287284.1 Gene:Ranbp9 FlyBaseID:FBgn0037894 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_490716.1 Gene:xpo-2 WormBaseID:WBGene00002079 Length:938 Species:Caenorhabditis elegans

Alignment Length:1028 Identity:185/1029 (18%)
Similarity:363/1029 (35%) Gaps:258/1029 (25%)


  Fly    21 LQNLLSSDTGVLQQTEKRIKQLEYTEGYGVYLSEIIMNQAHEL--PLRQIAIVMLTRYVENHWTD 83
            ||..|..|..:.::.|:.::.|:...||.:.:.::::|:..::  .:|..|.|.|..:|:.:|..
 Worm     8 LQQTLEPDAAIRKRGEEALRSLQSNPGYIIQILQLVVNEQQQIAPQIRIAAAVALKNFVKRNWGP 72

  Fly    84 DDDVKRKANGCMASEQAKRTIRNILPNGLYDPNSKIRSSVAHTISTIAATDYPHCWAELFDIIVK 148
            ..:|:      |..|..:: .|::|...:::..|.::..:::.:..||..|:|..|.:|...:.|
 Worm    73 APEVE------MGQEDEEQ-FRSMLLEAMFNTKSNVQEILSNALYLIAQRDFPEKWPDLVPYLSK 130

  Fly   149 CLGGNE-----DSIHGAMQVLQDFSYD---VEQIKELGPVVIP-------------EVYRIFDSE 192
            .|.|.:     .|:....|:.:.|.::   .|..|||...::.             ||.:..|..
 Worm   131 FLNGADLNHLVASLASMEQIFRKFRFESKSAELWKELKKCLLSTQEPLTLLLRNMMEVGQRKDQL 195

  Fly   193 QNYSIKTRVSAIRILKPLFASIAALITNKEEQSTMMSSILTNFMDKLMHYLSM-------NSGAV 250
            ....|...:..:.::..::.|:.:     :|........|.::|...:|.:.:       |||..
 Worm   196 GADEIAQWLRVLLLIAKVYHSLCS-----QEIPEYFEDHLKDWMPHFLHLVQIDAPTQTSNSGEP 255

  Fly   251 SSF-LLRTEIIKVFTHLVNEMPKYINPFMDRVLPIVWQLLTQIAETYVKVSVNQTETSPLASGDS 314
            ::. .|:.||.::||.......:.|:.|:..::..||.||              ..|.|      
 Worm   256 TTLDELKHEICEIFTLYSQRYEEEISEFVPDIILAVWNLL--------------KSTGP------ 300

  Fly   315 EEDDEQTNFQSLIIQILEFINCILTCNKLRGSI--KNVLADLI-YITIVYIQLSEEQLEDWHDDP 376
                 .|.:.:::...|||::.:.......|..  :.||..|. .:.:..:.|.::.:|.:.|:|
 Worm   301 -----DTRYDTMVCAALEFLSMVSQRQYYEGHFTGEGVLKTLAENVCVQNLLLRQQDMELFEDEP 360

  Fly   377 EKFVDDEDDGGVELTVRMCGRDVLLAINDEFGANAIQPLQEALGRHFSVADAEKAANNPNWWKIQ 441
            ..::..:.:|....|.|....|:...:...|.|..:..|.|.:         :....:.:|.|| 
 Worm   361 LDYMKRDIEGTDVGTRRRGAIDLARGLCRRFEAQMLPCLGEIV---------QNLLGSGDWIKI- 415

  Fly   442 EACMDAVHAFRDVILAGDST----FDLLNYLTIVRNLLVHQ----------ESPPLVGRALWTLS 492
                |.|::....|.....|    ....|.|..:.:..:.|          ::|.|...|| ..:
 Worm   416 ----DIVYSLITAIAVKTETAKSGVTATNPLVDINDFFITQVATHLNADVNQTPILKADAL-KFA 475

  Fly   493 IYSKSDLYNPQMLTEI--LDVTLCSLSPEKSHILRISAVRTLNGFLQANETIDGEKRTLLVSKL- 554
            :..:..|....::|.|  .|..|.|.:|    ||...|...:...|.|:.......:.|.||.: 
 Worm   476 VTFRKQLAPEHLMTAIKSADALLSSNTP----ILHKYAAYAIEKILLADSNKIFSAQNLPVSSIL 536

  Fly   555 ----------------PGFLDGIMALV----------PGSKAAVLALLMEALTFMVKFDAE---- 589
                            |..:..|:.::          ..:.|..||.|:|:.|   |..|:    
 Worm   537 QNLVTAFDKDAKAQNSPYLIKAILRIIVILDDDTIRHADAIAVKLAQLVESAT---KNPADSVHT 598

  Fly   590 -FAFAS---------------QAKITPLAIAVFLKYTED--PYVLETVQDLIKALCQRKECLGPL 636
             |.|.:               .|::.||...:|.:..||  ||.|:....|:.:...|...:   
 Worm   599 HFLFETICVLITKTRTIGASLDAQLLPLIEVIFREDLEDLIPYALQITGVLVSSCIARNSSI--- 660

  Fly   637 QEKFIPTIVSILGLTGAASTEKQDIALDVLNTIVRYTEPPLNNSLLETAFPAIINCVLHTDDHAV 701
             ::|.|.:..:|.....|.:.....||.||..|                                
 Worm   661 -DQFSPFLPFLLSERLWARSANVPAALSVLEVI-------------------------------- 692

  Fly   702 MVAGGECLRSFINVSPEQICSYKNGEGINCIMQVVATVLLNPMNSEMTAAGQIGRLVITIITKMG 766
                       ::|:.:::.|..:|..::.:.:::.:..|:....::.|         ||:..:.
 Worm   693 -----------LSVNAQRVVSENSGLILSHLARLLGSKTLDQYGFQLAA---------TILPSIE 737

  Fly   767 SMLGQNVDMLLKAVISKMQNLECLKVIMNLVLIFAHLFLTQMDAVLNFLSTVPGPNGEPAMQFVL 831
            ...|..:..:|..:..::|:.:..| .|.|.::|...|.....|                 |.::
 Worm   738 HFEGSAMTFVLNTMFRRVQSSKTPK-FMKLFIVFLCRFTIARSA-----------------QDLV 784

  Fly   832 TNWLSRQNSFFGNYERKVTTMALCKLFEYGVATQDNRLTTITFKELVDDPTDTRRRTRSVAATTQ 896
            .:..:.|...||....||..:.|..| :......:.|:..|....|:.|.|.             
 Worm   785 QSCENIQTGMFGMLIEKVVCIDLPGL-KQTTTGPEKRIIAIGMGNLLADVTQ------------- 835

  Fly   897 KWVTIPALVKIFKVLISEYQHFQEGKSDEP---LTDSEEDGDDEDAPG---NP 943
                  .||..:.:|..|.....|..|...   |:..||.....:|.|   ||
 Worm   836 ------QLVGQYGILSYEVAMLLEAASASDRAVLSPEEEQASMYNAEGEFVNP 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ranbp9NP_001287284.1 SXM1 14..891 CDD:227943 172/969 (18%)
IBN_N 36..114 CDD:281761 16/80 (20%)
xpo-2NP_490716.1 IBN_N 23..96 CDD:197981 16/80 (20%)
Cse1 150..512 CDD:285678 74/411 (18%)
CAS_CSE1 514..>832 CDD:281384 64/396 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.