DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-7

DIOPT Version :10

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 / 180983 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans


Alignment Length:65 Identity:25/65 - (38%)
Similarity:38/65 - (58%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPD---NPKAVERFHELSKALEILTDESARAAYDK 73
            |.:||:...:.:.||.|||||.|.:.|||...|   ..||.::|.:::.|.|:|.||..|..:|:
 Worm   381 YKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDIAAAKEVLQDEEKRRQFDQ 445

  Fly    74  73
             Worm   446  445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:395170 24/62 (39%)
RRM_DNAJC17 175..247 CDD:409863
dnj-7NP_509209.1 TPR 29..>198 CDD:440225
TPR repeat 29..54 CDD:276809
PEP_TPR_lipo 58..>410 CDD:274350 13/28 (46%)
TPR repeat 59..89 CDD:276809
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809
DnaJ 379..444 CDD:395170 24/62 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.